KEGG   Spirochaeta sp. Buddy: SpiBuddy_0389Help
Entry
SpiBuddy_0389     CDS       T01439                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
sbu  Spirochaeta sp. Buddy
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:sbu00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:sbu00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
420354..420905
Genome map
AA seq 183 aa AA seqDB search
MGQFTFTRTDIEGVLIIEPRVFGDERGYFMETYNKADFYKAGITCEFVQDNQSKSRKGVL
RGLHFQKQYPQAKLVRVTKGEVYDVAVDLRKESPTYGKYVGATLSAELKNQFFIPRGFAH
GFLVLSDEAEFTYKCDEFYHPEDEGGIRWDDPSIGIQWPEIGIEYCLSEKDKALSTLMGR
NDD
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
gtgggacagtttacattcaccaggacggatatagaaggggtgctcatcatcgagccgagg
gtgttcggtgatgagcgtggctacttcatggagacgtacaacaaggccgatttttacaag
gcgggcatcacgtgcgagttcgtgcaggacaaccagagcaagtcacgcaagggcgtactt
agggggctccatttccagaagcagtatccacaggcaaaacttgtgagagtgactaagggc
gaggtgtacgatgttgcggtggatttgaggaaggaaagccccacgtatggaaaatatgta
ggagctacacttagtgctgaattaaaaaaccaatttttcattccccggggcttcgcccat
ggattcctggtgctctccgatgaggccgagttcacctacaagtgcgacgagttctatcac
cccgaggacgagggtggcatcaggtgggatgacccgagtattgggattcagtggccggaa
attgggattgagtattgcttgagtgagaaggacaaggctttatccactttgatgggaaga
aatgatgactaa

DBGET integrated database retrieval system