KEGG   Sphaerochaeta globosa: SpiBuddy_0436Help
Entry
SpiBuddy_0436     CDS       T01439                                 

Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
sbu  Sphaerochaeta globosa
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:sbu00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SpiBuddy_0436
  Lipid metabolism
   00561 Glycerolipid metabolism
    SpiBuddy_0436
   00600 Sphingolipid metabolism
    SpiBuddy_0436
Enzymes [BR:sbu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     SpiBuddy_0436
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
475678..476997
Genome map
AA seq 439 aa AA seqDB search
MKITFLGAGSTVFARNVLGDCMGTEALRCAEMALYDINAKRLEESKRILQAINDTINEGR
ARITVYHGPGQLEAALQGARFVVNAIQVGGYDPATIIDFEIPKKYGLRQTIADTIGIGGV
MRALRTIPVMDEFAKVMQRVCPNALLLNYSNPMAMLTSYMLRYSAVQTVGLCHSVQICSE
TLLKGLGMEDKLEGRVETIAGINHMAWLLSLYDKNGNDLYPEIKRRAAQKNATQKHDDMV
RYEYIKHLGYYCTESSEHNAEYNPFFIKKGYPDLIDHFNIPLDEYPRRCIRQIDEWEDEW
KSIHNQGTIAHERSLEYASHIMESVVTNTPYKINGNVLNTGLIDNLDQSACVEVPCLVDG
SGVHPCKVGKLPVHLAAMNMTNVNVQLLTVEAAVSRKKEDIYHAAMLDPHTAAELSIDDI
VSLCDEMIEAHGPFMAMYR
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattacctttttaggagcaggcagcaccgtgtttgcacgcaatgtgctgggtgat
tgcatgggaaccgaggcgctcaggtgcgcagagatggcactctatgacattaatgcaaaa
cggctggaagaatcgaaacgtatcttgcaggccatcaacgataccatcaatgaaggacgt
gcccgtataacggtctatcatggacctggtcagctggaagctgccctgcaaggtgcccgc
ttcgtcgtcaatgccattcaggtgggagggtatgatcctgcaaccatcattgactttgaa
attcccaagaaatatgggttgaggcagacgattgccgatacaatcggcatcgggggtgtc
atgcgtgcgctgcgtacgattcctgtaatggatgagtttgcaaaagtcatgcagcgcgtc
tgccctaacgccctgttgctgaactactcgaatcccatggctatgcttacttcctatatg
ctgcgctattcagcggtacaaaccgtgggcttgtgccacagcgtgcaaatctgctcggaa
accctgctcaaaggactgggtatggaggacaagctggaaggacgggtggagaccattgcg
ggcatcaatcacatggcatggctgttgagtttgtatgacaagaatggcaatgacctgtat
cccgagatcaagagacgggccgcccaaaagaatgcgacacagaagcacgatgacatggtc
cgttatgagtatatcaagcaccttgggtattactgcaccgagtcgagcgaacataatgcc
gagtacaatccgttcttcatcaagaagggctatccggatttgatcgaccatttcaacatt
cccctggatgagtatcccagaaggtgcatccgtcagattgatgagtgggaggacgagtgg
aagagtatccacaaccaaggaacgattgcccacgaacgttcgcttgagtacgcttcccat
attatggaatcagtagttaccaatacgccgtacaagatcaacggcaatgtgctgaatacg
ggcttgatcgacaatcttgaccagagtgcgtgtgtcgaggttccttgtctggtggatgga
agcggtgtgcatccttgcaaggtagggaagcttcctgtgcatcttgcggctatgaacatg
accaatgtcaacgttcagctactcaccgtcgaggcggcggtcagcaggaagaaggaggac
atctaccatgctgcgatgcttgatcctcacacggcggccgagctttccatcgacgacatt
gtttccctgtgcgatgagatgattgaggcgcatggtcctttcatggccatgtatcgctga

DBGET integrated database retrieval system