KEGG   Spirochaeta sp. Buddy: SpiBuddy_0558Help
Entry
SpiBuddy_0558     CDS       T01439                                 

Definition
hypothetical protein
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
sbu  Spirochaeta sp. Buddy
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(598791..599723)
Genome map
AA seq 310 aa AA seqDB search
MWIIILLLLIAFILWNTTLIGYRDKQTQRLQTDESKVFCEMARSITYKQGSNTAILLVHG
FPSTPAMYTYSAKRFHDAGFDVYSPLMPGFGTDPKDLEQTTFTQWFDFICRYYEDLRSKY
ETLFVLGTSMGGLMTLKLGEHYCNSDKEPDKLVTIAAPVVYNSFREGIFTDKRQYIARTL
ALFKPSINVRIITENSKGEDGSDQWYGYGGTFIRPGLSLVHAMPSVRKNLGSITCPLFSI
HDVNDRVIPFKNLKIIEREQKSPNFRSLVTTMGDFNHGRHSLLSYHSIQASLTDTILDFL
QNKENSDAQT
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgtggattatcatactcctgttgcttattgcattcattctctggaacaccaccctcatc
gggtatagggacaagcagacccaaaggttgcaaaccgatgaatcgaaggtgttttgtgaa
atggcaaggagcataacatacaagcaaggcagcaacactgcaattctgcttgtccatgga
tttccttccaccccggctatgtatacgtacagtgccaagcgttttcacgatgcaggattc
gatgtctactctcccctgatgcctggcttcggtaccgatcccaaggatttggaacagact
acgttcacccaatggttcgacttcatctgccggtattacgaagacttgagaagcaagtat
gagaccttgtttgtactgggaaccagcatgggaggcctgatgactctcaaacttggtgaa
cactactgcaattccgataaagagcccgacaagctggtcaccattgcagccccggtggtc
tacaacagcttcagagaaggaattttcaccgataagcggcagtacatcgcccgcaccctc
gccctcttcaaaccctcgatcaatgtccgtatcatcactgaaaatagcaagggggaagac
ggcagcgaccagtggtacggctatggcggcacgttcatccgtccaggtctcagcctggtg
catgccatgcccagtgtcaggaaaaatcttggcagcatcacctgccccctcttctccatc
cacgatgtcaacgaccgtgttattcctttcaagaatctgaaaattattgaacgtgaacag
aaaagccccaatttccgctcgcttgtcaccactatgggagacttcaaccatggtcgtcat
tccctgctttcctatcactcgatccaagcatcactgaccgataccattttggattttttg
cagaataaggagaattccgatgcccaaacgtaa

DBGET integrated database retrieval system