KEGG   Sphaerochaeta globosa: SpiBuddy_0581Help
Entry
SpiBuddy_0581     CDS       T01439                                 

Definition
phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
sbu  Sphaerochaeta globosa
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sbu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SpiBuddy_0581
   01230 Biosynthesis of amino acids
    SpiBuddy_0581
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SpiBuddy_0581
   00030 Pentose phosphate pathway
    SpiBuddy_0581
   00051 Fructose and mannose metabolism
    SpiBuddy_0581
   00052 Galactose metabolism
    SpiBuddy_0581
  Energy metabolism
   00680 Methane metabolism
    SpiBuddy_0581
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    SpiBuddy_0581
Enzymes [BR:sbu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SpiBuddy_0581
Protein phosphatases and associated proteins [BR:sbu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SpiBuddy_0581
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
620178..621353
Genome map
AA seq 391 aa AA seqDB search
MHENLLIIHGGAPTAVMNASLYGVIKQAKDSGVCRHVYAARGGTQAVLTEDFIDLLTIDE
QTIAQLPHTPASWIGTSRFHVSDDDYAKMVEVLLECNITGVFFNGGNGSMDACGKLARAI
KAHPIARSKGIRVVGIPKTIDNDLAITDHAPGFGSAARYLASSVQELSQDVASLPIHVCI
IESMGRNAGWLTAAAALAKTEERVGPHLIYVPEVAFDEERFLDEARSLYEKHGGVVVVAS
EGLRTTEGSPIVKPIFQVGRSVYYGDVSAHLCNLVIQKLGIKARSEKPGILGRCSIAFQS
EVDRDEAILAGREAVKALLEGKSEVMVGFERINSEPYLCKTILIPLEQVMLHERTLPIQY
VRDAGKIDEAYLAWCKPLIGSPLASFPKREV
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgcatgagaatttgttgataattcatggtggggcaccgacagcggtgatgaatgcctcc
ttgtatggggtaatcaagcaggcgaaggattcgggagtatgccggcatgtttatgctgca
agaggggggacgcaagccgtccttacagaggatttcatcgatctcttgaccatcgatgaa
cagactattgcacagttgccccatacccctgcctcatggatcggtacaagccgctttcac
gtcagtgacgatgactatgccaagatggtggaagtcttgctcgaatgcaatatcaccgga
gtattcttcaatggaggcaatggttcgatggacgcctgcggcaagctggctagagccatc
aaagcccatccgatagcgagaagtaaaggtattcgggtggtgggtatccccaagaccatc
gacaacgatttggccatcaccgatcatgctcctggtttcggcagtgctgcccgttacttg
gcctcctcggttcaggaactgagccaagatgtggcatcgcttcccattcatgtctgtatt
atcgagagtatgggtcggaatgcaggctggcttaccgccgccgcagcattggcaaagaca
gaagagcgtgtaggtccccatctcatctacgtacctgaagtagcctttgatgaagagcgt
ttcctcgatgaggcgaggagcctgtatgagaaacatggaggcgtggtagtggtagcctct
gaggggttacggaccactgaaggctctcctattgtgaagccaatctttcaagtagggcga
tcggtctactatggagatgtatcggcacacctgtgcaatctggtgatccagaaattggga
atcaaggcacgtagtgagaaaccaggcatcctcgggcgctgttccatcgccttccaatcg
gaagtcgaccgcgatgaggcaatcctggccggtagggaagccgtcaaagccttgttggaa
ggtaagagtgaggtaatggtaggctttgagcgcatcaacagtgagccctatctttgcaag
actatcctcatcccccttgagcaagtcatgttgcacgaacgtaccttgcctatacagtat
gtgagggatgccggaaaaattgacgaagcatatctagcttggtgcaaaccattaatcggc
tctccacttgcttcttttcctaagcgtgaggtgtag

DBGET integrated database retrieval system