KEGG   Spirochaeta sp. Buddy: SpiBuddy_0585Help
Entry
SpiBuddy_0585     CDS       T01439                                 

Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
sbu  Spirochaeta sp. Buddy
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:sbu00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:sbu00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:sbu00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(624856..627210)
Genome map
AA seq 784 aa AA seqDB search
MISKKDRLFNLSTKHTSYLFAITETGHLEHLYYGRFLSNPTISVDALSEKRSLNIGTSTA
YDSDHPTLFLTNLCMEYSTMGKGDYRECSVTIEYTKGMQTLDFIVKSFRILPGKPRTFSG
LPESYGDKSTCTTLEITLKETCLPIRMTLTYTVFEDSDVITRRATIYNDSTSSVRIKNLA
SAQLDLDADDWNLVTFDGTWARERYMNERALLPGIYINDSKTGVSSADHNPCIFLKKDDG
ECIGMNLIYSGNHRELVEVSPYGKIRVMTGINPATFSWELSAQDRFQSPEAVLTYSHQGM
NGASANFHHFINNHIVRGTWKLRERPILINNWEATYFNFTEDKLLTLAKESADLGIELFV
LDDGWFGLRNDDTTSLGDWTVNPKKLPSGLAWLSLEVHRLGMMFGLWVEPEMISIESQLY
KKHPDWMIAIPGRRPSVGRNQYILDLSRQDVRDYLFKSLSETWHLADVNYIKWDMNRVFS
DLYSANAEIHNHQEFFHRYVLGLYDLLGKLTQAFPNVLFESCASGGNRFDLGMLCYMSQT
WTSDNTDALCRLYIQEGTSCGYPLSTMGSHVSSSPNHQTLRRTDLEARFNVAAFGVLGYE
LDITKLNRQQKEAVRSQIAFYKAHRSLLQYGIFTRIKLANSPSNQIVWAVASQDKSELLV
LFAQKLNLPNPASDKLRVEAVDLHAVYEVFPRQQKIDIKMFGDLLNRVSPVSITEGGLAQ
DTISKALSLESEIEHYRVSGEQVAFGGIKLNQQFGGTGYDAMTRVLGDFGSRIYIFKKIN
LESK
NT seq 2355 nt NT seq  +upstreamnt  +downstreamnt
atgatttccaagaaggaccgactgttcaacctttcgaccaagcatacctcctatctgttt
gccataaccgaaacgggccatttggagcacctctactatggaaggttcctatccaatcca
accattagtgtcgatgccctttctgagaagcggagcctgaacatcggaacgagcactgca
tacgacagcgaccaccccaccttgtttctcacaaacctctgtatggaatattctaccatg
ggaaagggcgactatcgagagtgttcggtcactattgaatacaccaaaggtatgcaaacc
ctcgatttcatcgttaaaagcttccgcattcttcccggcaagccgagaacgttcagcgga
ctgcccgagtcctacggggataaaagtacttgcaccaccttggagataacactgaaggag
acttgcctaccgatcagaatgacccttacctataccgtctttgaggacagcgacgtcatc
actcgcagggcaaccatctacaacgacagcacaagcagcgtccgtatcaagaaccttgcc
tcggcacagctcgacctcgatgccgatgactggaatctggtaaccttcgacggaacttgg
gcgcgtgaacggtacatgaatgaacgtgcgctgcttccaggtatctacatcaacgacagc
aaaaccggtgtatccagtgccgatcacaatccctgcatattcctgaagaaggatgacggg
gagtgcatcggaatgaacctgatctacagcggtaaccaccgtgaactggtcgaggtctcc
ccctatggaaaaatcagggtgatgaccggcatcaaccctgcaacattcagctgggagctc
agtgcccaggaccggttccagtcccctgaagctgttcttacctactcccatcagggtatg
aacggtgcaagtgctaatttccatcatttcatcaacaaccatatcgtccgggggacttgg
aaactgcgcgaacgaccgatccttatcaataactgggaagccacctacttcaatttcacc
gaggacaagttgctcaccctggccaaggagagcgccgacttgggcattgaactcttcgtg
ctcgacgatggatggttcggacttcgcaacgacgataccacaagcctcggagattggacc
gtgaacccgaaaaagcttccctcaggtctggcatggctgagtcttgaggtacaccgcctt
ggcatgatgttcggtctctgggtcgaaccggaaatgatcagcatcgagagccaactatac
aagaagcatcccgattggatgatcgccatcccaggtcgcagaccgagtgtcggacgcaac
caatacatcctcgacctcagccggcaggatgtacgcgactatttattcaagagcctctca
gagacatggcaccttgccgatgtgaattacatcaagtgggatatgaaccgggtgttcagc
gatttatatagtgcaaatgccgagatacacaaccaccaggaattcttccatcgctatgta
ttgggcctgtacgaccttctaggcaagctcacccaagcattccccaatgtgctttttgag
tcgtgtgcaagcggtggaaaccgctttgacctgggtatgctgtgctatatgagccagaca
tggaccagcgataataccgacgcactttgcaggctctacatccaggaaggaaccagctgc
ggctacccgctctcaacaatgggaagtcatgtcagttcctcccccaaccaccaaacactg
cgtcgaaccgacttggaggctcgcttcaatgtggcagccttcggagtgctggggtatgaa
ctggatatcaccaagctcaaccgtcagcaaaaagaagcggtcagaagccagatcgccttc
tataaggcccaccgttccctgcttcagtatggaatcttcacacgcatcaagttggccaac
agcccttccaatcagattgtttgggcggtggcaagccaagataagagtgagttgcttgta
ctcttcgcccaaaagctgaacctgcccaaccctgcttcagacaagttgagggtggaagcc
gtcgatttgcatgccgtgtatgaagtattcccccgccagcaaaaaatcgacatcaagatg
ttcggtgacttactcaaccgcgtcagcccggtttccatcactgaaggcggccttgcccag
gataccatcagcaaggccctctcacttgagagtgaaatcgagcactaccgggtcagcgga
gaacaggttgcctttgggggcataaagctgaatcagcagttcggagggaccggatacgat
gccatgacacgcgtattgggtgacttcggcagcagaatctacatttttaagaagatcaac
ctagaaagcaagtaa

DBGET integrated database retrieval system