KEGG   Sphaerochaeta globosa: SpiBuddy_0665Help
Entry
SpiBuddy_0665     CDS       T01439                                 

Definition
(GenBank) Histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
sbu  Sphaerochaeta globosa
Pathway
sbu00340  Histidine metabolism
sbu01100  Metabolic pathways
sbu01110  Biosynthesis of secondary metabolites
sbu01230  Biosynthesis of amino acids
Module
sbu_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:sbu00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    SpiBuddy_0665
Enzymes [BR:sbu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     SpiBuddy_0665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: ADY12492
JGI: SpiBuddy_0665
UniProt: F0RUR4
Position
700249..701565
Genome map
AA seq 438 aa AA seqDB search
MAYLARFYDPQDEELPQLLARNKTNSQDLSTRVSAILRAVREEGDRALFRFSKQFDQVDL
SELRVTEKEIQEAEHKLSDDLKKALSVAYKNIHAFHSEQLPRPETLSVAPGIELSRRIVP
LQRVGLYIPGGTAPLFSTTLMLAIPAQVAACPSVVLCTPPDKEGKVHPAILYAASMCKVK
EIYKIGGSQAIAAMAYGTQSIKAVDKIFGPGNQYVTEAKIQVSSSCCAIDMPAGPSEVMV
LASPSSNPAFVASDLLSQAEHGRDSQAMLVVCADRKEGFAFLDKVEQAIEEQLATLGRQE
YLLASLASSRAFVNPVLTRCVALANAYAPEHLIITMQDETVENQIAEQIVNAGSLFLGPY
SCESAGDYASGTNHTLPTNGWARCYSGVSTDSYLKKITVQKLSKAGLENLAPTLFTMADG
EMLNAHKNAVAIRLGGKR
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atggcctatcttgcgcgattctatgacccacaagacgaagaactgccacaattgctcgcc
cgcaacaagaccaattcccaagacttgagcactcgggtgagtgccatcctcagggcggta
cgagaagaaggcgatagagcgttgtttcggttttccaagcaatttgaccaggttgatctt
tccgagttgcgggtcactgaaaaagaaatacaggaagctgaacacaagctttccgacgat
ttgaagaaagccctgtctgtggcgtataaaaacatccatgccttccacagcgagcaactt
ccccgtcctgaaaccctttctgtagccccgggtatcgagctttcccgtaggattgttccc
ctccaacgggttggcctctatatcccaggagggactgcacctctcttttccaccaccttg
atgctggccatcccagcccaggtggccgcctgtccttcggtggtgctctgtaccccccct
gacaaggagggaaaggtacaccctgccattctgtatgctgcatcgatgtgcaaggtgaaa
gaaatctataaaataggcggatctcaggctattgccgccatggcctatgggacacagagc
atcaaagctgtggacaaaatctttggcccgggcaaccagtatgtcaccgaggcgaaaatt
caggtgagcagcagttgctgtgccatcgatatgcctgcaggtccgagcgaggtgatggtc
cttgcttccccttcatccaatcctgctttcgtagccagtgatttgctcagccaagccgag
cacggtcgggacagccaggcgatgctggtggtctgtgcagatagaaaggaagggttcgct
tttttggacaaggttgagcaagccattgaagagcagcttgccacccttggtagacaggaa
tacctgctagccagtctggcaagcagtcgagcgtttgtgaatcctgtccttacgcggtgt
gtggctctggctaatgcctatgcccccgagcacctcattatcactatgcaggatgaaact
gttgagaaccagatcgcagagcagatagtcaatgcaggttccctcttcctcggcccctat
tcctgcgagagtgcaggcgattatgccagcggtactaaccacaccctgcctaccaacggc
tgggcaagatgctacagcggggtaagcaccgattcctatctgaagaaaattaccgtccag
aagttgagtaaggcgggcttggaaaaccttgctccaaccttgttcacgatggccgatggc
gagatgttgaatgcacacaagaatgcagttgcgattcgattgggaggaaagagatga

DBGET integrated database retrieval system