KEGG   Sphaerochaeta globosa: SpiBuddy_0770Help
Entry
SpiBuddy_0770     CDS       T01439                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
sbu  Sphaerochaeta globosa
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SpiBuddy_0770
Enzymes [BR:sbu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     SpiBuddy_0770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
816785..818299
Genome map
AA seq 504 aa AA seqDB search
MKYNIRRCGVLMHPTSLPSKHGIGSLGDEAFQFLDLLKKTSVRLWQILPLGPTGYGDSPY
AARSSFAGNELLIDLKSLAYDGYLDVEDVLFTPAFPSDRVDYGMVRFYKEPLLEKAAQQF
LKDAEPDEQAAYQSFVAENAWWLDDYALYQVLCKHYNDSRWFEIWPEELRLRKTAALKKA
QKEFHSQIELIMVQQYFFFTQWQKVKTYANTHGIQIIGDIPIFVAPDSVDAWANRHLLKM
DENGRQTVSSGVPPDAFSDDGQLWGNPVYDWKAHQKEGFAWWIKRIQKTLEACDIVRIDH
FRGFAAYWEVPQGEKTAMNGSWVEAPGKQLFEALTQKLGAQLPIIAEDLGVITEDVEELR
DSNNFPGMKILQFAFNVKDGTLDASNAYLPHNCIYNSVIYTGTHDNNTTRGWYEALDGAS
KDVLRRYLECPDEQVVWQLIRQMLLSCSKDAILPMQDWLELGAEGRMNIPSTCGQSNWSW
RARSLNVEPWRIDRLRSLIELSGR
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacaacatacgacgttgcggagtgcttatgcaccccacctcattaccctcaaaa
cacggaatcggctcgcttggcgatgaagctttccaatttcttgacctcttaaaaaaaaca
tcggtacgcctatggcaaatccttcccttggggcctaccggctacggtgacagcccctac
gcagcccgctcttcctttgcaggcaatgaactgcttatcgatcttaagagccttgcctat
gacggatatctggatgtcgaggatgtactcttcacccctgcgttcccttccgatcgagtc
gattacggcatggtgcgtttctacaaggaacccctgcttgaaaaagcagctcaacagttt
ctcaaggatgcagaacccgatgaacaggcagcttatcagagctttgttgctgagaatgcc
tggtggttggatgactatgccctctatcaggtgctctgtaagcactataacgactcccgc
tggtttgaaatctggcctgaggaactccgacttagaaaaactgcagccttgaagaaggct
caaaaagagttccattcccaaattgagctaattatggttcaacaatactttttcttcacc
cagtggcaaaaagtaaaaacatacgccaacacccatggcatccaaatcatcggggacatt
cccatattcgttgcaccagacagtgtcgatgcttgggcgaacagacacctattgaaaatg
gacgaaaatggtaggcaaaccgtttccagcggtgtgccacccgatgccttctcggatgac
ggccaactgtggggtaatccagtctatgactggaaagcccaccaaaaggaaggctttgcc
tggtggatcaagagaattcagaaaaccttggaagcttgtgacatcgtacgtatcgaccac
ttccgtggctttgccgcctactgggaagtcccgcagggagagaagactgcaatgaacggc
agctgggttgaagcaccgggaaagcagctgtttgaagcactgacccaaaaactgggggcg
caacttcccatcattgcagaggatttgggggtaataaccgaggatgtggaggagcttagg
gattccaacaacttcccgggcatgaaaattctccagtttgccttcaatgtgaaagacgga
acattggatgcatcaaacgcataccttcctcacaactgtatatacaacagcgtcatctac
accggaacgcatgacaacaacaccacccgcggctggtatgaagccttggatggtgcaagc
aaggacgtactccgacggtacctcgaatgtcccgatgagcaggtggtttggcaactgatc
aggcaaatgctgctcagttgctcaaaggatgctatcctgccgatgcaggactggcttgaa
ctcggagccgaagggagaatgaacatcccctcgacctgcggccagagcaactggagctgg
agagccaggagcctgaatgtagagccttggcgaatcgaccgcctgcgctcgttgattgaa
ctcagcggacgttag

DBGET integrated database retrieval system