KEGG   Spirochaeta sp. Buddy: SpiBuddy_0908Help
Entry
SpiBuddy_0908     CDS       T01439                                 

Definition
xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
sbu  Spirochaeta sp. Buddy
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SpiBuddy_0908
   00051 Fructose and mannose metabolism
    SpiBuddy_0908
Enzymes [BR:sbu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     SpiBuddy_0908
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
972057..973385
Genome map
AA seq 442 aa AA seqDB search
MQYFVGQEEYFKGIGKIQFEGKGSKNPLAFRYYDAKKVIAGKTMEEHLRFATAYWHSFCA
DGTDPFGNSTIDFPFRKADKYENAVAKADAAFEFFTKLGTPFYCFHDIDASPDHEVAAEY
EKTYHKIADELLARQKASGIKLLWNTANVFSHPNYMNGAATNPDFKVVSRAAVQVKNSLD
VNVKLGGSNYVFWGGREGYMSLLNTDMKREQEHLARFLTMARDYGRSIGFKGTFLIEPKP
MEPTKHQYDYDAATTIGFLKNWGLEKDFKCNIEANHATLAGHTFSHDLQVCADNGMLGSV
DANQGDSINGWDTDEFPSNVYETTQAMLVILRNGGLGNGGLNFDAKRRRNSTDLEDLFIA
HIGGMDSFALGLEVAQKILDDGVIDSFVKERYSSFDKGDGKKFEEGKLSLAELAELGRNA
KIEKKSGKQEYLNNLLNSYLFG
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgcagtattttgttggacaagaagagtatttcaaaggaatcggtaaaattcagttcgaa
ggaaaggggagcaagaaccctttggctttcagatattatgatgctaagaaggtaattgcc
ggcaagaccatggaagaacatcttcgttttgccaccgcctactggcatagcttctgcgct
gatggcaccgacccgttcggcaactccaccatcgactttcccttccgcaaggcggataaa
tatgagaatgctgtagccaaggctgatgctgcattcgaattctttaccaagctcggtact
ccgttctattgcttccatgacatcgatgcttctcccgatcatgaagtggcagccgagtac
gagaagacctatcataaaattgccgatgagctgcttgcccgccagaaggccagtggcatc
aagcttttgtggaataccgccaatgtgttttcacaccccaactacatgaatggtgcggct
accaatcctgatttcaaggtggtttcacgcgctgctgtacaggttaagaacagccttgac
gtgaacgtcaagctcggtggttccaactatgttttctggggaggccgtgagggctatatg
agcctgctcaatacggatatgaagcgcgagcaggagcaccttgcacgcttcttgacgatg
gccagggattatggacgcagcatcggtttcaagggtaccttcctgatcgaacccaagccg
atggaaccgaccaagcaccaatatgactacgatgcggcaaccaccatcggtttcttgaag
aactggggcttggagaaggatttcaagtgcaatattgaagctaaccatgcaacactggcc
ggtcatacgttcagccatgatttgcaggtctgcgccgacaatggcatgctcggcagcgtt
gatgccaaccagggcgactcgattaatggttgggacaccgatgagttccccagcaatgtg
tatgaaaccacgcaggcaatgttggtcattctcagaaacggtggacttggcaacggcggt
cttaacttcgatgccaagagacggcgcaactccaccgaccttgaggatttgttcatcgcc
cacatcggtggcatggatagttttgctcttggtcttgaggtagcccagaaaattttggac
gacggcgtaatcgattcctttgtgaaggaacgctatagctccttcgataagggagacggc
aagaagtttgaggaaggcaagcttagtctggcagaactcgcagagcttggacgcaatgcc
aagattgagaagaagagcggtaagcaggagtatctgaacaacctgttgaattcctacctc
ttcggctaa

DBGET integrated database retrieval system