KEGG   Sphaerochaeta globosa: SpiBuddy_0965Help
Entry
SpiBuddy_0965     CDS       T01439                                 

Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
sbu  Sphaerochaeta globosa
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sbu00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SpiBuddy_0965
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SpiBuddy_0965
   00620 Pyruvate metabolism
    SpiBuddy_0965
   00650 Butanoate metabolism
    SpiBuddy_0965
  Lipid metabolism
   00071 Fatty acid degradation
    SpiBuddy_0965
  Amino acid metabolism
   00350 Tyrosine metabolism
    SpiBuddy_0965
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SpiBuddy_0965
   00626 Naphthalene degradation
    SpiBuddy_0965
Enzymes [BR:sbu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SpiBuddy_0965
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     SpiBuddy_0965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1035207..1037870)
Genome map
AA seq 887 aa AA seqDB search
MADTQIGELFAGQEELQALIERVKRAQIKFSTYSQEQVDTIFRAAAIAANDERIKLAVMA
VKETGMGIVEDKVIKNHFSAEYIFHKYKDDKTCGVIETDAGFGIKKIAEPKGVICGIIPT
TNPTSTAIFKSLISLKTRNAIIFSPHPRAKECTCEAARIILEAAVKAGAPEDIIAWIEEP
SMEKTDYLMHNPLVNLILATGGPSMVKSAYSSGIPAIGVGPGNTPALVDKSADIKMAVSS
ILMSKTFDNGVVCASEQAVICHKDIYDAVKEEFVNRGARFLSSEEADLLRKVIIDPKRKT
VNPAIVGQSATKVASIAGFKVPAATKVLIGEVDSIEENEPFAHEKLSPVLAMYKCDNFGD
GTNKAAKLVALGGFGHTSVLYIDETETEKVETYSKTVKTSRILVNMPASQGAIGDIYNFR
LEPSLTLGCGSWGNNSISENVGPKHLLNIKTEAARRENMLWFKLPPKIYFKYGSLPIALG
ELKGKKRAFIITDSFLFTSGMVEKITDTLDSLGIETETFHQVKPDPTLATITEGMKLINA
FKPDVLIGLGGGSPMDAAKIMWLLYEHPEVKFEGLALRFMDIQKRIYAFPDMGKKAELVC
IPTTSGTGSEVTPFAIITDEKTGMKWAIADYALTPSMAIVDSELAMGQPKGLTASCGLDV
LTHALEALASSMSTDYTNGLSLEAARMIFKYLPQAYRNGDDKKAREKVHNASTIAGMAFS
NAFLGVCHSMAHKLGAQFHVPHGMANALLLCNVIRYNATDNPTKQAAFPQYEYPSAVSRY
ARAADYIAMAVNDQENTPYIQTTVSDTQAMRVQALVAGIEKLKKELDIPSSIKEWGIKEE
EFLAVVDELAMKAFDDQCTGSNPRYPLISEIKQLYLDSFYGRAYTEA
NT seq 2664 nt NT seq  +upstreamnt  +downstreamnt
atggcagacacacaaattggagagctttttgcaggacaagaagaactgcaagccctcatc
gaacgggtaaaacgtgcacaaatcaaattctcaacctatagccaagaacaggttgacacc
atattccgcgctgccgccattgcggctaacgacgaacgcatcaaactcgctgtcatggct
gtcaaggagacaggcatgggtatagtcgaggacaaggtcatcaagaaccacttctccgcc
gagtatatcttccacaaatacaaggatgataagacgtgtggtgtgatcgagaccgatgca
gggttcggtatcaagaagattgccgaaccaaagggagtcatctgcggcatcatccctact
acaaaccccaccagtacggcaatattcaagagcctcatcagcttgaaaacccgcaatgcc
attattttcagcccccacccccgtgcaaaggagtgcacctgtgaggctgcaagaatcatt
cttgaggccgctgtgaaagctggtgcacccgaggatatcatcgcttggatcgaagaaccc
tccatggaaaagaccgattacctgatgcacaaccccttggtgaaccttattcttgcaacc
ggtggcccttccatggtcaagagtgcctattcctcaggaattcccgccatcggggtggga
ccgggcaacaccccggctttggtggacaagagtgccgatataaaaatggccgtcagttcc
attctcatgtccaaaacctttgacaacggtgtggtttgtgcttccgaacaagcagtcatc
tgccataaggatatctatgacgcagtgaaagaggaatttgtgaaccggggagcccgcttt
ctctcttctgaagaagccgacctgcttcgcaaggtgatcatcgaccccaagcgcaaaacg
gtcaatcctgcaattgtcgggcagagtgcaaccaaggttgccagcattgccggctttaag
gttcccgctgcaactaaagtccttatcggcgaggtcgattccatcgaggaaaacgagcct
ttcgcccacgaaaagctcagccccgtccttgccatgtacaagtgtgacaacttcggtgat
gggacgaacaaggcagccaagctggtcgccctcggaggctttggccataccagtgtcctc
tatatcgatgaaacagagacagagaaagtcgaaacctacagcaagacggtgaaaaccagc
agaattctggtgaatatgccagcaagccaaggtgccatcggggatatctacaacttccgc
ctcgaaccttctttgacgttgggctgcggcagttggggcaacaactccatcagtgagaat
gtgggtcccaagcacctgttgaacatcaagactgaagctgcaaggagagagaatatgctc
tggttcaaactacctcccaaaatctatttcaaatatggttcgcttcccatcgctctggga
gaactcaagggcaagaaacgtgctttcatcatcaccgattcttttctttttaccagcggt
atggtagagaaaatcaccgacacgttggacagcctcggcattgagacggagacctttcac
caagtaaagcccgaccccaccctggcaacgattaccgaaggcatgaagctcatcaacgcc
ttcaagcccgatgtactcatcggtttgggtggaggttcccccatggatgcagcgaaaatc
atgtggctgctctatgagcatcccgaggtcaagttcgaaggccttgccttacggttcatg
gacatccaaaagcgcatctacgccttccccgacatgggtaagaaggcagagctggtatgt
atccccaccaccagcggcaccggcagtgaagtcaccccgtttgccatcatcaccgatgag
aagacgggaatgaagtgggcgatcgccgactatgccctcaccccgagcatggccattgtg
gacagtgaactggccatgggccaacccaagggcttgacggcaagctgcggcctggatgtt
ctgacccatgctttggaagctctggcctcaagcatgtccaccgattacaccaacggactg
agccttgaagctgcccgcatgatcttcaagtacttgccgcaggcctatcgcaacggtgat
gacaagaaagcccgtgagaaggtacataatgcctccaccatcgccggtatggcattttcc
aatgcatttttgggtgtttgccactcaatggcccacaagctgggtgcacagttccatgta
ccgcatggaatggccaatgccttgttgctttgcaatgtcatccgctacaacgccaccgac
aatcccaccaagcaggcagccttccctcagtacgaatacccgtctgctgtgagtaggtac
gccagggcggccgattacattgccatggcagtcaatgaccaggagaatacaccgtatatc
cagaccacagtcagtgatacgcaagcgatgagggtacaagcattggttgctggaattgaa
aagctgaagaaagagctggatatcccctcctccatcaaggaatggggcataaaggaagag
gaattcctagccgtggttgacgagctcgccatgaaggcgttcgatgaccaatgtacggga
tccaatccccgctatccgctgatcagcgagatcaagcagctgtacctcgactccttctat
ggaagggcgtatacagaagcgtaa

DBGET integrated database retrieval system