KEGG   Sphaerochaeta globosa: SpiBuddy_0977Help
Entry
SpiBuddy_0977     CDS       T01439                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
sbu  Sphaerochaeta globosa
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Butirosin and neomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sbu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SpiBuddy_0977
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SpiBuddy_0977
   00052 Galactose metabolism
    SpiBuddy_0977
   00500 Starch and sucrose metabolism
    SpiBuddy_0977
   00520 Amino sugar and nucleotide sugar metabolism
    SpiBuddy_0977
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SpiBuddy_0977
   00524 Butirosin and neomycin biosynthesis
    SpiBuddy_0977
Enzymes [BR:sbu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SpiBuddy_0977
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1049062..1049946)
Genome map
AA seq 294 aa AA seqDB search
MSVYVGLDIGGTSVKVLGLNEEAQICFESSFATNSERGIEAFVKTCDDTITKHIKACNAN
LAGIGIGCTGPVDYRSGVIENPYTLPGLEGHSISDLLNKACKVPVLVDNDANTAHIGEVF
QHAPAPENTLMITFGTGVGVSVRMEGELFRIPGGIHPEIGHITTSVFAQDYCYCGRNNCM
EHILSGTGINKHALLQYGCTAEELMQTKDSLFADALETALCDAVSTLATLFHPTCVYIGG
GMQRFFESYVLQAVQERLDAFLPVYGRTKLEPCIAGSRAGSLGAALMAYRNEGR
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtctatgtcggtttggatatcggaggaacctcggtcaaagtacttggcctgaat
gaggaggcccaaatttgttttgagtcctcctttgctacaaattcagaacgagggatcgaa
gcttttgtaaaaacgtgtgacgataccatcacaaaacatatcaaagcatgcaatgccaat
ttggctggtatcggtatcggttgtaccggtcccgtagattatcgcagcggggtgattgag
aacccgtatacgttacccggcttggaaggacatagtatcagcgacctattgaacaaagct
tgcaaggttcctgtactggtcgacaacgatgcgaatacagcacatatcggggaagtattc
cagcacgctcctgcaccggagaatacgcttatgatcacctttgggacaggagtaggtgtc
tcggtccggatggaaggcgaactattcagaattcctgggggcatccacccagaaatcggg
catattaccaccagcgtttttgcccaagattattgttattgtggccgaaacaactgcatg
gagcacatcctatccggcactggcatcaataaacatgccctcctgcaatatggttgtact
gccgaagagcttatgcaaaccaaagatagtttgtttgctgatgcattggaaaccgctctt
tgtgacgcagtcagcacattggcgacgcttttccatcctacgtgtgtctatatcgggggt
ggtatgcagcggttttttgagtcctatgtactacaagcagtccaagaaagactcgatgct
tttcttccggtctatggaagaaccaagctcgaaccttgtatcgccggctcacgggcaggc
agtcttggtgctgcattgatggcttatagaaatgaagggagatga

DBGET integrated database retrieval system