KEGG   Sphaerochaeta globosa: SpiBuddy_0977Help
Entry
SpiBuddy_0977     CDS       T01439                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
sbu  Sphaerochaeta globosa
Pathway
sbu00010  Glycolysis / Gluconeogenesis
sbu00052  Galactose metabolism
sbu00500  Starch and sucrose metabolism
sbu00520  Amino sugar and nucleotide sugar metabolism
sbu00521  Streptomycin biosynthesis
sbu00524  Neomycin, kanamycin and gentamicin biosynthesis
sbu01100  Metabolic pathways
sbu01110  Biosynthesis of secondary metabolites
sbu01120  Microbial metabolism in diverse environments
sbu01130  Biosynthesis of antibiotics
sbu01200  Carbon metabolism
Module
sbu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sbu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SpiBuddy_0977
   00052 Galactose metabolism
    SpiBuddy_0977
   00500 Starch and sucrose metabolism
    SpiBuddy_0977
   00520 Amino sugar and nucleotide sugar metabolism
    SpiBuddy_0977
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SpiBuddy_0977
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    SpiBuddy_0977
Enzymes [BR:sbu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SpiBuddy_0977
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK FGGY_N
Motif
Other DBs
NCBI-ProteinID: ADY12804
JGI: SpiBuddy_0977
UniProt: F0RV82
Position
complement(1049062..1049946)
Genome map
AA seq 294 aa AA seqDB search
MSVYVGLDIGGTSVKVLGLNEEAQICFESSFATNSERGIEAFVKTCDDTITKHIKACNAN
LAGIGIGCTGPVDYRSGVIENPYTLPGLEGHSISDLLNKACKVPVLVDNDANTAHIGEVF
QHAPAPENTLMITFGTGVGVSVRMEGELFRIPGGIHPEIGHITTSVFAQDYCYCGRNNCM
EHILSGTGINKHALLQYGCTAEELMQTKDSLFADALETALCDAVSTLATLFHPTCVYIGG
GMQRFFESYVLQAVQERLDAFLPVYGRTKLEPCIAGSRAGSLGAALMAYRNEGR
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtctatgtcggtttggatatcggaggaacctcggtcaaagtacttggcctgaat
gaggaggcccaaatttgttttgagtcctcctttgctacaaattcagaacgagggatcgaa
gcttttgtaaaaacgtgtgacgataccatcacaaaacatatcaaagcatgcaatgccaat
ttggctggtatcggtatcggttgtaccggtcccgtagattatcgcagcggggtgattgag
aacccgtatacgttacccggcttggaaggacatagtatcagcgacctattgaacaaagct
tgcaaggttcctgtactggtcgacaacgatgcgaatacagcacatatcggggaagtattc
cagcacgctcctgcaccggagaatacgcttatgatcacctttgggacaggagtaggtgtc
tcggtccggatggaaggcgaactattcagaattcctgggggcatccacccagaaatcggg
catattaccaccagcgtttttgcccaagattattgttattgtggccgaaacaactgcatg
gagcacatcctatccggcactggcatcaataaacatgccctcctgcaatatggttgtact
gccgaagagcttatgcaaaccaaagatagtttgtttgctgatgcattggaaaccgctctt
tgtgacgcagtcagcacattggcgacgcttttccatcctacgtgtgtctatatcgggggt
ggtatgcagcggttttttgagtcctatgtactacaagcagtccaagaaagactcgatgct
tttcttccggtctatggaagaaccaagctcgaaccttgtatcgccggctcacgggcaggc
agtcttggtgctgcattgatggcttatagaaatgaagggagatga

DBGET integrated database retrieval system