KEGG   Spirochaeta sp. Buddy: SpiBuddy_1008Help
Entry
SpiBuddy_1008     CDS       T01439                                 

Definition
peroxiredoxin (EC:1.11.1.15)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
sbu  Spirochaeta sp. Buddy
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:sbu00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:sbu00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1079717..1080262
Genome map
AA seq 181 aa AA seqDB search
MSVYDYTVRGRKGEEVKLSTYKGNVLLIVNTATQCGFTPEYTELEKLYEAYRAKGFEILD
FPCNQFDGQAPESIEEIHEICTLKFGTQFPQFGKVDVNGEGAIPLYKYLKDKKGFAGFDM
SHKIAPILDGILRKANPEYEKSSEIKWNFTKFLIDRNGEVVSRFEPSYDLGKVAKAIEKL
L
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtatatgattacaccgtacgcggaagaaaaggagaggaagtaaaactctccacc
tataagggcaacgtgctcttgatcgtaaatactgcaactcagtgtgggtttacccccgaa
tacactgagcttgagaaattgtatgaagcatacagggcgaagggctttgagatcttggac
ttcccctgcaaccagttcgatgggcaagctcctgagtcgattgaggagatccacgaaatc
tgtacgctgaagttcggtacccagtttccccagttcgggaaggttgatgtcaacggtgaa
ggtgcaatcccgttgtacaaatacctgaaggacaagaagggattcgcagggttcgacatg
agccacaagatcgcccccattcttgatggaatcctgcgcaaagcaaaccctgaatatgag
aagagcagtgagatcaagtggaactttaccaagttcctcattgaccgcaacggtgaagtt
gtttcccgttttgaaccttcttacgacctgggcaaggtagccaaggccatcgagaaactt
ttgtaa

DBGET integrated database retrieval system