KEGG   Spirochaeta sp. Buddy: SpiBuddy_1086Help
Entry
SpiBuddy_1086     CDS       T01439                                 

Definition
pectinesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
sbu  Spirochaeta sp. Buddy
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:sbu00040]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:sbu00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1167853..1168806
Genome map
AA seq 317 aa AA seqDB search
MNTLTVDQSGKGHYCSIQEALDAVPYAEQAMIIIEQGVYHEKLFCDKRNVHLVGRGEVVI
SNSDGAKEKIDVLPKRGTFRSYTAFFSGEFLRMEHVTIQNNAGAGSEAGQGVALYLDVDC
SYLTDVRLLGCQDTLFVAPLPEREREANGFYGPRCFAKRKLNTLFFDQGYIQGDVDFIFG
GADALFRHTEICSSATGFVTAPSTCKKDIGLVFDHCTFTAKESVPPESVYLMRPWREEGK
AAFLSCTLGDHINKKLRIDWPGHEGLGEGTLSCHQCHYTDQGRTDKAFELSSIQAISLLD
AIEQRCKVFHQSLYGDV
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgaacacactgactgtcgaccaatcaggcaaggggcattactgcagcatccaggaagca
ttggatgccgttccctatgctgaacaggccatgatcatcatcgaacaaggcgtataccac
gaaaagcttttctgcgataaacgcaacgtgcatctggtgggaaggggagaggtggtcatc
agcaattccgacggcgcaaaagagaaaattgatgtacttcccaagcggggtacgtttcgc
tcctatactgcttttttcagtggtgaattcctgagaatggaacatgttaccatacagaac
aacgccggggcgggaagtgaggcggggcagggggtagccctgtatctcgatgtcgactgt
tcctacctcaccgatgtccgtcttttaggctgccaggataccctttttgtcgctccgctt
ccagagagggagcgcgaagcgaatgggttttatggaccgcgatgctttgccaaacgcaag
ctgaatacgctttttttcgaccaggggtatatccaaggcgacgtcgatttcattttcggg
ggtgctgatgcactctttcggcatacggagatttgcagtagtgcaacaggctttgtgacg
gccccctcgacatgcaaaaaagatattggtttggtgttcgatcattgtaccttcacagct
aaagagtctgtcccgcccgaatcggtgtacttgatgcgtccttggagggaagaaggcaag
gcagccttcttgtcgtgtaccctcggtgaccatatcaacaagaaactacgcatcgattgg
cccggccatgaaggccttggtgaggggaccctcagctgtcatcaatgtcattatacagac
caaggccgtaccgataaggctttcgagctttccagcatccaggcgatctcgcttttggat
gccatcgagcaacgctgcaaagtattccaccaaagcctctacggggatgtgtga

DBGET integrated database retrieval system