KEGG   Spirochaeta sp. Buddy: SpiBuddy_1405Help
Entry
SpiBuddy_1405     CDS       T01439                                 

Definition
Holliday junction ATP-dependent DNA helicase ruvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
sbu  Spirochaeta sp. Buddy
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:sbu03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1529152..1529784)
Genome map
AA seq 210 aa AA seqDB search
MINAIIGDVVRVMDGEVILRAGYVEYMLSVSAQTASKLSNLSLEERRAVRLLTVLIHRED
SMSLFGFYDEAEREAFLQLQTVSGIGSKQALKILSGISVRNLAQALDTGNLKLLSSIPGI
GPKTGQKMILALRDVLVFEDEKSKTNGQRSQSKASQWSDIITALVDMGYDRRKVEEVIDS
LSEQESEAIGKLSHHDAEQLLFRSAVKLLG
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgattaacgctatcattggtgatgtagtacgtgtaatggacggtgaggttatcctcagg
gcagggtatgttgaatatatgctctctgtgtcggcacagacagcaagcaagctcagcaat
ctatcattggaagagagaagggctgttaggttgcttaccgttttaatacatcgcgaggac
agcatgtccctttttggcttttatgatgaagccgaacgcgaagcttttttgcagttgcaa
accgtctccggcataggctcgaaacaagctctcaagattctcagcggtatcagcgttcga
aatctggcacaagcacttgatacggggaacctgaagcttttatcctcgattccgggcatt
ggtcccaagacaggtcaaaaaatgattctcgccttgcgtgatgtattggtctttgaagat
gaaaagagcaaaaccaatgggcagcgtagccaaagcaaagccagtcagtggtcggacatt
attactgcattggtggatatggggtatgatagacgtaaagttgaagaggtaatcgattcg
ttaagcgaacaagaatctgaagcaatcggcaaacttagccaccatgatgctgagcaactg
ttgttccgcagtgcagtcaaactgcttggataa

DBGET integrated database retrieval system