KEGG   Sphaerochaeta globosa: SpiBuddy_1434Help
Entry
SpiBuddy_1434     CDS       T01439                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sbu  Sphaerochaeta globosa
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:sbu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SpiBuddy_1434
   01230 Biosynthesis of amino acids
    SpiBuddy_1434
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SpiBuddy_1434
   00051 Fructose and mannose metabolism
    SpiBuddy_1434
   00562 Inositol phosphate metabolism
    SpiBuddy_1434
Enzymes [BR:sbu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SpiBuddy_1434
Exosome [BR:sbu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SpiBuddy_1434
  Exosomal proteins of bladder cancer cells
   SpiBuddy_1434
  Exosomal proteins of melanoma cells
   SpiBuddy_1434
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1555867..1556619)
Genome map
AA seq 250 aa AA seqDB search
MRKPYIAGNWKMNMTPSEGAAFAKELVKALQGSSTKVMIAPPFVTIPAVVEAVKGSSIIV
AAQNMSDNLNGAFTGEVSALMLKDLGVTNVILGHSERRALYGETDQFINKKVLLALSQGM
DVDLCIGETLSEREGGKLEELLTRQITEGLKGVTELQMKHITLAYEPVWAIGTGKTATPE
DADSAHAFIRSLIEKLYTKGVAEELIIQYGGSVKASNAKALMSKEHIDGALVGGASLSVE
QFLPIVNFDR
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaccctatattgcaggcaactggaaaatgaatatgacccctagcgaaggtgct
gccttcgccaaggagttggtcaaggctttgcagggctcttcaaccaaggtaatgattgct
ccccccttcgttaccattcccgctgtcgtagaggctgtaaaaggctcgtccattattgtt
gcagcccagaatatgagcgacaatctcaatggcgcgtttactggtgaggtgagtgctctg
atgctcaaggacctcggggttaccaacgtcattcttggacacagtgaaagaagagccttg
tatggtgagaccgaccagtttatcaacaagaaggtattacttgctctctctcaaggcatg
gatgttgatttgtgcattggcgaaaccctttctgaacgggaaggcggcaagcttgaggaa
ttattgaccaggcagatcactgaaggtttgaaaggtgttaccgagcttcagatgaagcac
attaccttggcatacgaaccggtgtgggctattggaaccgggaaaacagcaactcccgaa
gatgctgattcagctcatgcttttatccgctctcttattgaaaaactctatacaaagggt
gttgcagaagagctcattatacagtatggtggttcagtgaaggcttcgaatgcgaaagcc
ttgatgtccaaggagcatatcgatggtgcattggtcggcggagcttctctttcagtggag
cagttccttccgattgtgaacttcgataggtaa

DBGET integrated database retrieval system