KEGG   Sphaerochaeta globosa: SpiBuddy_1710Help
Entry
SpiBuddy_1710     CDS       T01439                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sbu  Sphaerochaeta globosa
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sbu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SpiBuddy_1710
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SpiBuddy_1710
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SpiBuddy_1710
Enzymes [BR:sbu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SpiBuddy_1710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1871271..1872539)
Genome map
AA seq 422 aa AA seqDB search
MKFVSTRGKEPAVTASEAIMQGLAPDGGLYVPQSFPALTHLAIHEISSYPELAFEVLAPF
FEDDPLKDDLAEICMDAFNFPVPLVTLRDQETVLELFHGPTAAFKDFGARFLAACMERML
TKEQRKLTILVATSGDTGGAVAAAFAGRKGIDVKVLYPKGRVSGRQQQQLTCWGGNIQAY
EVDGSFDDCQKMVKDAFMDSELSQQWGLSSANSINLGRLLPQSVYYVFASHLYTQAFGKK
PIFIIPSGNVGNSCAAFWALTMGAPIEQIVLSVNENKTIPDFLSSGTYQTRASVQTLANA
MDVGAPSNMERLFNLYPNTDTLRSMISAYAVNDQTIEATIKEVYEELGYILCPHTATGER
VRRDHFAGKPTIVVSTAHPAKFEQVVEPLIKQTVEVPENLAKLLMKPSSFKAIGTDYRQL
FN
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgaagtttgtatcaacacgcggtaaagagccggcagtcactgccagtgaagccattatg
caaggactggccccggatgggggcctgtatgttccccaatcgtttcctgccctgacgcat
cttgcaatccatgagatatccagctaccccgaacttgcgttcgaagttctcgcacccttt
tttgaagatgatccactgaaggatgaccttgcagaaatctgcatggatgccttcaatttt
cccgttcccttggttacgcttcgggaccaggagacggttcttgaacttttccacggccct
acggcagcgttcaaggatttcggggcccgcttccttgcagcatgcatggagcgcatgctt
accaaagagcaacgcaagctcactatcctggttgccaccagcggtgataccggaggggcg
gtagccgcagcgtttgccggtcgtaaaggcattgacgtgaaggtattgtatcccaagggc
cgggtgagcggacgccaacagcaacaacttacctgctggggtgggaatattcaggcgtat
gaggttgacggatccttcgatgactgccagaaaatggtcaaggatgccttcatggattcg
gaactctcccagcaatggggactctccagtgccaattccatcaatctggggcggctcctt
ccccagagtgtgtactacgtgtttgcttcccatctctatacccaggcgttcggcaaaaaa
ccgatcttcattattcccagcggcaacgtcggcaacagctgtgcagctttctgggctttg
acgatgggagctcccatcgagcagattgttctttcggtgaatgagaataaaaccattccc
gacttcctaagtagcggaacctaccagacacgagcttcggtgcaaaccttggcaaatgcc
atggatgtaggggccccgagcaatatggaacgtcttttcaacctctatccgaataccgat
accctcagaagcatgatcagcgcctatgccgtaaacgaccaaacgattgaagccacgatc
aaggaggtctatgaggagcttgggtatattctttgccctcatacggctacaggagaaagg
gtcagacgggaccattttgcaggcaagcccaccattgtggtttctaccgcccacccggcc
aagtttgagcaagtggtcgagccattgatcaaacagaccgttgaggttcctgagaatctg
gccaagttgcttatgaagccttccagcttcaaggcgatcggcactgattacaggcagttg
ttcaactaa

DBGET integrated database retrieval system