KEGG   Sphaerochaeta globosa: SpiBuddy_1760Help
Entry
SpiBuddy_1760     CDS       T01439                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
sbu  Sphaerochaeta globosa
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbu00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SpiBuddy_1760
  Lipid metabolism
   00600 Sphingolipid metabolism
    SpiBuddy_1760
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SpiBuddy_1760
Enzymes [BR:sbu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     SpiBuddy_1760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1920612..1922951)
Genome map
AA seq 779 aa AA seqDB search
MYQEIPANNGWSFFPGFEEAFLKPDFDSSSWPQVDLPHSPHLFEIGYKKEGFHQGLSTYR
RKFSVQKEEKHLLALRFDGIANSAVFYCNGKQVGSCTGPYLPYTLELGTLEECVLTVVVD
ATENPQFPPFGGSMDYITFCGIYRLVTLIIKENESLSFVYASSTEADSVHIHGRAVNSES
RRVQVRLYDQEVLLAKGETVIEKGSFSLSLGNLSLKRWSLNDPYQYTVEVTLADKQTKVV
RFGSRSAEFRSDGFYLNSEKLVLTGLNRHQDYPYVGYAAPPSLQREDAKLLKAIGVNLVR
TSHYPQDPSFLSACDELGLLVFEEIPGWQHIGGQEAWRKACLENTQAMIERDCNHPSIIL
WGVRVNESADDHELYQATNALARNLDPYRQTGGVRNLKHSEFLEDVYTYNDFSYAGKGKG
LQKKTNVCPRQVPYLVTEYCGHIYPTKRFDPPMVRSEHALRHYRILDAAHATVGLSGAIG
WCMHDYYTHANFGSGDQICYHGVTDLARNLKAAAFVYQSQLDEKPLLCVLSSMEGGDHPN
ACLDQAVVATNCDAVRLWFNEDEVGLFYPDRRQFPHLAHPPVIIRDFIGDRLKAEAYLTE
KQRKALARLLGKVGRQAVQLTLLDTAKLGFFLARHRKKYGDAVRMFNTYVGNWGSKEAVW
RFEGLIDGKVVARQVIEQALAPSLQLKCSTNTLSLGLSTYDMAQVQVLITKAGQLLPLSY
ACIGFSVSVEGPLILASPSVSCTVGGSAVIYVRTKQEAGEATLTVHSALGDTTIHFAVG
NT seq 2340 nt NT seq  +upstreamnt  +downstreamnt
atgtaccaagagattcccgccaacaatggttggtctttttttccgggctttgaagaagcg
tttctgaaacctgattttgacagcagttcgtggccacaggtagacctgccgcacagcccc
cacctgtttgagattggctataaaaaagagggttttcatcagggtttatcgacctaccga
cgcaaattctccgtccaaaaggaggaaaaacacctgcttgccctccggttcgacggtatc
gcaaacagtgctgttttctactgcaatggcaagcaggttggcagttgcacgggaccctac
ctgccgtatacccttgaactcggaacattggaggaatgtgttcttaccgttgtcgtcgat
gctacggaaaatccgcagtttcctcccttcggtggaagtatggattacatcaccttttgc
ggcatctatcgcttggtcaccctgatcatcaaagaaaacgagagcctgtccttcgtgtat
gcatcgagtaccgaagctgatagtgtgcacattcatggcagggcagtaaacagtgaatct
cgcagagtgcaggttcgcttgtatgaccaagaagtactccttgccaaaggagagaccgtc
atagagaagggctccttctcactttcacttggcaacctttctcttaagcgttggtctttg
aacgacccctatcagtacaccgtggaagttacacttgccgataagcaaaccaaggttgtc
cgcttcggcagcaggtcggccgaattcagaagcgacggtttctatctcaactcagaaaag
cttgtactgacaggactcaaccgtcaccaagattacccctatgtggggtatgcagcaccc
ccgagcctacagcgtgaggatgcgaagttgttgaaggctatcggagtaaatctggtacga
accagccattatccgcaagatccgagttttctgagtgcctgtgatgaactgggcctgctg
gttttcgaggaaattcccggatggcagcacatcggagggcaggaggcatggagaaaggct
tgtcttgaaaacacacaggcgatgatcgagcgggattgcaatcacccaagcatcatcctg
tggggtgtgcgggtcaacgaatcagctgacgatcatgaactctaccaagcaacaaacgct
cttgcgagaaacctcgatccctatcgtcagacagggggggtgcgcaatctcaagcacagt
gaattccttgaggatgtctatacctacaacgatttttcctatgccggcaagggaaaggga
cttcagaagaaaacgaacgtgtgcccccgccaggtaccgtaccttgtgactgaatactgt
ggtcatatctatccgaccaagcgattcgatccgcctatggtgcgtagcgagcatgccctc
aggcattatcggatccttgatgcagcacacgctactgtcgggctctctggtgccatcggc
tggtgcatgcacgactattacacccatgcaaatttcggtagcggagaccagatctgctac
catggggtcaccgacctggcacgcaacctgaaggctgcggcctttgtctaccagagccag
ctggacgagaagcccctgctttgcgtgctgtccagcatggaagggggagaccatccgaat
gcctgcctcgaccaagcggtggttgccaccaactgtgatgcggtacgactttggttcaat
gaggatgaggtgggacttttctaccccgacaggaggcaattcccccacctggcccatccc
cctgtcattatcagggactttatcggcgatcgacttaaagcagaggcttatcttaccgaa
aagcagaggaaagcccttgcaagactcctaggcaaggttggcaggcaagctgtacagctg
accctcctcgatactgccaaattgggcttcttcctagctcgccatcgaaagaaatatggc
gatgcggtacgcatgttcaatacgtatgtgggcaactggggaagcaaagaagccgtttgg
cgtttcgaaggtttgatcgatgggaaggtggtggcccgacaggtcattgagcaagccctt
gctccttctttacagctcaagtgctcgacgaacacactctccttgggcctttctacctat
gatatggcccaagtccaggtgctgataaccaaagccgggcaactgctgcccctcagttat
gcctgtatcggtttctcagtcagtgttgaaggtcctcttattttagctagtccctcggtc
agttgcaccgtaggaggtagtgcagtgatttacgtgagaacgaaacaagaggccggtgag
gcaacgctgacggttcactctgcattgggtgacacaacaatacattttgcagtaggctag

DBGET integrated database retrieval system