KEGG   Sphaerochaeta globosa: SpiBuddy_1820Help
Entry
SpiBuddy_1820     CDS       T01439                                 

Definition
(GenBank) Threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
sbu  Sphaerochaeta globosa
Pathway
sbu00260  Glycine, serine and threonine metabolism
sbu00750  Vitamin B6 metabolism
sbu01100  Metabolic pathways
sbu01110  Biosynthesis of secondary metabolites
sbu01120  Microbial metabolism in diverse environments
sbu01230  Biosynthesis of amino acids
Module
sbu_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sbu00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SpiBuddy_1820
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SpiBuddy_1820
Enzymes [BR:sbu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SpiBuddy_1820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Cys_rich_CPCC HypA
Motif
Other DBs
NCBI-ProteinID: ADY13644
JGI: SpiBuddy_1820
UniProt: F0RWL3
Position
1994659..1995882
Genome map
AA seq 407 aa AA seqDB search
MRFTYECCDCHTVYETDEVFYQCPKCAHENDGTSFPKGNVIVKLNQDDLKALQGKEHVSM
YDFFPYPVPTPEVYPVGGTPLAKPLRLGKKYGLKNISCKLDSALPSGSFKDRASQLIAAQ
AIAHKQHKIALASTGNAGAAMSCAGAAYGLEIILFVPATAPINKLMQSVLYGATVVPVKG
SYDDAFALSIAYTKEFGGINRNTAYNPMTIEGKKSVSIELFEQMGRSVPDVVYVSVGDGC
IFAGVYKGFYDLKEAGLIKKIPHLVCAQSKQSNAISRAWKTGDFSNLAKATTRADSISVE
SPANGRMAVRYINESEGWATEVDDKQILAAQLELAKEAGIFVEPAAACAWAALAADSEML
VKRFGSEVKVCTLLTGTGFKDMAVFQGTVSIPESIENSVEAVQKRFK
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgcgttttacctatgagtgttgtgattgccacaccgtctatgaaacggatgaagtattc
tatcaatgtccgaagtgtgcccatgagaatgatgggacatcttttccaaaaggcaatgtc
attgtcaagctcaaccaggatgacctaaaggcgttgcaaggcaaagaacatgtcagcatg
tatgactttttcccctacccggttcccactcccgaagtgtatccggtaggaggcacccca
cttgcaaaacctctgcgtcttggcaaaaaatatggattgaagaacatcagttgcaagctt
gacagcgccctaccctccggttcattcaaggacagggccagtcagttgatcgcagcccaa
gcaatcgcccacaagcagcacaaaatagctctggcatccactggaaatgccggcgctgca
atgagttgtgcaggtgcagcctatggacttgagataatcctattcgttcctgctaccgca
ccgatcaacaagcttatgcagagtgtcctctacggggctaccgttgttccggtgaagggc
tcctacgacgatgcgtttgctctctccattgcctataccaaggagtttgggggtattaac
cgcaatactgcgtacaacccgatgaccatcgaagggaagaagagtgtctctatcgaactc
tttgagcaaatgggaagaagcgtgcctgatgttgtatatgtttcggtgggtgacggatgc
atctttgcaggagtctacaagggcttttatgacttgaaggaagctggactcatcaagaaa
atcccgcatctggtatgtgcacaaagcaagcagagcaatgcaatcagcagggcatggaaa
accggcgatttctcaaatcttgcaaaagctaccacccgtgccgactccatcagtgttgaa
agtcctgcaaacggccgcatggcagtccggtatatcaacgaaagtgaaggctgggcgacg
gaagtggatgacaagcaaattcttgctgcacagcttgagttggccaaggaagccggaatt
tttgttgaacctgcggctgcatgtgcctgggcggcattggcagcagacagcgaaatgctt
gtcaaacggtttggatcggaagtgaaggtatgtactttgctgacagggaccggattcaag
gatatggctgttttccaaggtacggtttccattccagaatccattgagaatagtgttgag
gctgttcaaaagcgattcaagtaa

DBGET integrated database retrieval system