KEGG   Sphaerochaeta globosa: SpiBuddy_1820Help
Entry
SpiBuddy_1820     CDS       T01439                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sbu  Sphaerochaeta globosa
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sbu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SpiBuddy_1820
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SpiBuddy_1820
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SpiBuddy_1820
Enzymes [BR:sbu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SpiBuddy_1820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1994659..1995882
Genome map
AA seq 407 aa AA seqDB search
MRFTYECCDCHTVYETDEVFYQCPKCAHENDGTSFPKGNVIVKLNQDDLKALQGKEHVSM
YDFFPYPVPTPEVYPVGGTPLAKPLRLGKKYGLKNISCKLDSALPSGSFKDRASQLIAAQ
AIAHKQHKIALASTGNAGAAMSCAGAAYGLEIILFVPATAPINKLMQSVLYGATVVPVKG
SYDDAFALSIAYTKEFGGINRNTAYNPMTIEGKKSVSIELFEQMGRSVPDVVYVSVGDGC
IFAGVYKGFYDLKEAGLIKKIPHLVCAQSKQSNAISRAWKTGDFSNLAKATTRADSISVE
SPANGRMAVRYINESEGWATEVDDKQILAAQLELAKEAGIFVEPAAACAWAALAADSEML
VKRFGSEVKVCTLLTGTGFKDMAVFQGTVSIPESIENSVEAVQKRFK
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgcgttttacctatgagtgttgtgattgccacaccgtctatgaaacggatgaagtattc
tatcaatgtccgaagtgtgcccatgagaatgatgggacatcttttccaaaaggcaatgtc
attgtcaagctcaaccaggatgacctaaaggcgttgcaaggcaaagaacatgtcagcatg
tatgactttttcccctacccggttcccactcccgaagtgtatccggtaggaggcacccca
cttgcaaaacctctgcgtcttggcaaaaaatatggattgaagaacatcagttgcaagctt
gacagcgccctaccctccggttcattcaaggacagggccagtcagttgatcgcagcccaa
gcaatcgcccacaagcagcacaaaatagctctggcatccactggaaatgccggcgctgca
atgagttgtgcaggtgcagcctatggacttgagataatcctattcgttcctgctaccgca
ccgatcaacaagcttatgcagagtgtcctctacggggctaccgttgttccggtgaagggc
tcctacgacgatgcgtttgctctctccattgcctataccaaggagtttgggggtattaac
cgcaatactgcgtacaacccgatgaccatcgaagggaagaagagtgtctctatcgaactc
tttgagcaaatgggaagaagcgtgcctgatgttgtatatgtttcggtgggtgacggatgc
atctttgcaggagtctacaagggcttttatgacttgaaggaagctggactcatcaagaaa
atcccgcatctggtatgtgcacaaagcaagcagagcaatgcaatcagcagggcatggaaa
accggcgatttctcaaatcttgcaaaagctaccacccgtgccgactccatcagtgttgaa
agtcctgcaaacggccgcatggcagtccggtatatcaacgaaagtgaaggctgggcgacg
gaagtggatgacaagcaaattcttgctgcacagcttgagttggccaaggaagccggaatt
tttgttgaacctgcggctgcatgtgcctgggcggcattggcagcagacagcgaaatgctt
gtcaaacggtttggatcggaagtgaaggtatgtactttgctgacagggaccggattcaag
gatatggctgttttccaaggtacggtttccattccagaatccattgagaatagtgttgag
gctgttcaaaagcgattcaagtaa

DBGET integrated database retrieval system