KEGG   Sphaerochaeta globosa: SpiBuddy_1932Help
Entry
SpiBuddy_1932     CDS       T01439                                 

Definition
(GenBank) Aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
sbu  Sphaerochaeta globosa
Pathway
sbu00010  Glycolysis / Gluconeogenesis
sbu00052  Galactose metabolism
sbu01100  Metabolic pathways
sbu01110  Biosynthesis of secondary metabolites
sbu01120  Microbial metabolism in diverse environments
sbu01130  Biosynthesis of antibiotics
Module
sbu_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:sbu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SpiBuddy_1932
   00052 Galactose metabolism
    SpiBuddy_1932
Enzymes [BR:sbu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     SpiBuddy_1932
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ADY13755
JGI: SpiBuddy_1932
UniProt: F0RWX4
Position
complement(2105822..2106853)
Genome map
AA seq 343 aa AA seqDB search
MLTKRSVATTAEGDDIYLITLTQGPYSAEILSLGANLKTLKTPDRRGEIRDIVLGFDNPL
DNLTSTTYFGQVVGRFANRIAKATFSLEGKTYTLDTNDGKNNLHSGSSNWGWRNWLVETF
DWNGDPGVVLSLFSPSGEGGFPHSVTCTVSYVLKSNGDLRIDYEATASGPTPINLTNHSY
FNLGGAGSGTILGHEVQLACDRYLEVDSALIPTGKILDVQGTAFDFTKRKSIGRDIEQAG
GYDHCFILSRSSEKLVEFASVYEPDSGRTMKISTTMPAVQMYSGNFLKAKEIGKGKVAYP
KHGGVCFETQYYPDSPNHSEFPSCIFSKERSFKHTTVFSFGCK
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgttaaccaaacgctcggttgccactaccgctgaaggcgatgatatctatttgattacc
cttactcaaggaccgtattctgctgagattctaagccttggggccaatctgaaaaccttg
aagactcctgaccgtaggggtgagattcgagatattgtccttgggtttgataatcccttg
gacaaccttacatcgacaacctactttggtcaggttgttggtcgctttgccaatagaatt
gccaaagccacattcagtttggaaggtaagacctacacgctggatacgaatgatggaaag
aacaatcttcatagtggcagcagcaactggggttggcgcaattggctggtggagacgttt
gattggaatggggatcctggtgtggtgttgagccttttcagcccctccggtgaaggtggt
tttcctcattctgttacctgtacagtctcgtatgtactgaagagcaatggtgatttgcgt
atagactatgaagcaaccgcctccggcccgactccgatcaatttgactaatcacagttat
tttaatcttgggggcgcaggcagtggtactattttgggccacgaagtacagctcgcctgc
gaccggtatcttgaggtggactccgcattaattccgacaggaaagattcttgatgtccag
gggacggcctttgatttcacgaagagaaagagtattggaagggatatcgagcaagccggc
ggatatgaccattgtttcattctttcccgaagctccgagaaacttgttgaatttgcttcg
gtttatgaaccggatagtggccgtaccatgaaaatcagtacaactatgccggctgtacaa
atgtattcgggaaacttcctcaaggcgaaggaaatcggtaagggaaaggttgcctatccg
aagcatggaggggtatgttttgaaacccagtactatccggatagtccgaatcatagtgaa
ttcccctcttgcatttttagcaaggaacgaagtttcaagcatacaactgtctttagtttt
gggtgtaaatag

DBGET integrated database retrieval system