KEGG   Sphaerochaeta globosa: SpiBuddy_1939Help
Entry
SpiBuddy_1939     CDS       T01439                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
sbu  Sphaerochaeta globosa
Pathway
sbu00900  Terpenoid backbone biosynthesis
sbu01100  Metabolic pathways
sbu01110  Biosynthesis of secondary metabolites
sbu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sbu00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SpiBuddy_1939
Enzymes [BR:sbu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     SpiBuddy_1939
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: ADY13762
JGI: SpiBuddy_1939
UniProt: F0RWY1
Position
complement(2113915..2114799)
Genome map
AA seq 294 aa AA seqDB search
MDTVCSRPAYAKVNLHLAVGLPYPDGYHPIQSLFALVDLSDSITLQWKESKTFDVKVTGL
EAYCSAQNDTLTKAARLWHEAGGYPLSLDIRCDKQIPVKAGLGGGSSDAAVLLQMLQDID
PKRALPLETLKDVASQVGSDVPFFLSGYCAALVTGKGENVTPLEGRKMHVVLVMPTYFDV
STSSAFRLLDEMRGTQKEVSWLSIQELLQIYKKPSHNWKGSLYNDFEPCSGNDAFYETLS
SLCEGYEGYYSMSGSGACWFFVSENVSHVHDVHAAVAAAFGSRVRCWLTHLMSC
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atggataccgtgtgttcgcgtcctgcctatgccaaggtaaatttgcatttggctgtcggg
cttccttatccggatgggtatcatcccatccagtccctgtttgcattggtggatctcagt
gattccatcacgttgcaatggaaagagagcaagacgttcgatgtaaaggtaactggcttg
gaagcgtattgcagtgcccagaacgataccctgacgaaggcagcccgcctctggcatgaa
gccggggggtatccactttcgcttgacatccgttgtgataagcagattcctgtcaaagct
gggcttggaggcggttccagcgacgcagctgtcctgctgcagatgctgcaagatattgat
cccaagcgggcattaccgttggagacgctcaaagatgttgcgtcgcaagttggtagtgac
gtacctttttttctttcgggatattgtgcggcgcttgtaacagggaaaggcgaaaacgtt
acacctttggaagggcgaaagatgcacgtggtattggtgatgccaacctattttgacgtg
tctacgtcatcggcatttcgtttgcttgatgaaatgagaggcacgcaaaaagaagtttcc
tggctgagcatacaggaattgttacaaatatataaaaaaccttcccataattggaagggt
tcattgtataatgatttcgagccgtgctcgggcaatgacgctttttatgagacactgagt
agtctttgtgaaggatatgaaggatattatagcatgagcggtagtggagcctgttggttt
ttcgtcagtgagaatgtttcccacgtccacgatgttcatgccgctgttgccgccgctttt
ggctctcgtgtcaggtgttggctaacacacttgatgagttgctag

DBGET integrated database retrieval system