KEGG   Sphaerochaeta globosa: SpiBuddy_1940Help
Entry
SpiBuddy_1940     CDS       T01439                                 

Definition
uracil-DNA glycosylase
Orthology
K10800  
single-strand selective monofunctional uracil DNA glycosylase [EC:3.2.2.-]
Organism
sbu  Sphaerochaeta globosa
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:sbu00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    SpiBuddy_1940
Enzymes [BR:sbu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.-  
     SpiBuddy_1940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2114901..2115671)
Genome map
AA seq 256 aa AA seqDB search
MLALQEKVIERTKIFAQQVETLRFSCDCYIYNPLTYAWPMHELYIRTYLSNPIRTLLLGM
NPGPFGMTQTGVPFGEIEAVKNFLKLDAEISKPLTEHPGRPVLGLKTQRSEVSGRRLWGL
IADHYGSAQAFAQEMAVINYCPLVFLDRKPTAKNITPDMLVKGERLALETICDRYLIDMI
ELLEPTYLIGIGKYAMQKFTHVASQRPGVVISSILHPSPASPQANRGWKEKTETHLSSLG
VWTLDKSKNCIVFPDN
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgctcgcactgcaagaaaaggtcattgaacgtacaaaaatcttcgcacaacaagttgaa
acgcttcgtttcagctgcgattgctatatctacaacccattgacttatgcttggccgatg
catgaattgtatattcgcacctatctcagcaatccaatcagaactcttttgctggggatg
aatcccggtccttttgggatgacgcaaaccggtgttcccttcggcgaaatagaagcagta
aagaactttctgaagcttgatgcagagatttcgaagcctttgacggaacaccccggcaga
ccggtacttggtttgaagacgcaacgaagcgaagtcagtggaaggcgcttgtggggtctg
attgcagatcactatgggagcgcccaagcttttgcccaggagatggctgttataaactat
tgtccattggtttttttggatagaaaaccaacagccaaaaacattactcccgatatgctg
gtaaaaggggagcgccttgccttggaaaccatatgcgatcgataccttatagacatgatt
gagctccttgagcccacctatttgatagggatcggtaaatatgcgatgcaaaagtttact
catgttgcgagtcaaagacctggggttgtgatatcttcaattctccatccaagcccggca
agtcctcaagcaaatcgtggatggaaggaaaagactgaaacgcatctctcctcgttggga
gtctggactttggataaatccaagaattgtattgtttttccagacaattaa

DBGET integrated database retrieval system