KEGG   Sphaerochaeta globosa: SpiBuddy_1954Help
Entry
SpiBuddy_1954     CDS       T01439                                 

Definition
alpha/beta hydrolase fold protein
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
sbu  Sphaerochaeta globosa
Brite
Enzymes [BR:sbu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     SpiBuddy_1954
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2130270..2131112)
Genome map
AA seq 280 aa AA seqDB search
MQITYEVPNFAEHHYQDKAPIRKCARPWAMVHDEAVKKAVLLCHGYTGYPGELIRPGTDL
FEAGFDVYCPRYPGHGTSGKDFLSSKAEDWIGTAYDAFAYLAQRYEHVSLVGHSMGGAIA
TIIADAFDADTLALLAPALVIPSLPATQVRILRHVVKRKKVAWKADLEYHFHYEGDADDD
AFLGSEYWSYQFPKGIWELERVRRRAVASIDHVLADTLSISGGLDPTIPEEASVLVTSKP
KGVNKHLHIKTIGHLMPYDKNIDAQNEAMAAVVAWMQGKR
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgcagataacatatgaggttcccaacttcgcagaacaccattatcaggataaggcaccg
atcagaaagtgtgcacggccgtgggccatggtccatgatgaggcggtgaaaaaggccgta
ttgttgtgtcatgggtatacaggttatccgggtgaactcattcgtcccggtaccgattta
tttgaggcgggctttgatgtgtactgcccccggtacccgggacatggaaccagtggaaaa
gattttttatccagcaaagccgaggattggatcggtactgcctatgacgcttttgcatac
cttgcccaacgctatgagcacgtttcgttggtaggccattccatgggtggggcgattgcc
accattattgctgatgcttttgatgcagacaccctggctttgcttgctcctgccttggtg
atcccctcgctgccagccacccaggtaaggattctcaggcatgtggtcaaacgtaagaaa
gtcgcctggaaggcggatctggagtatcatttccactatgagggcgatgctgacgatgat
gcctttttaggctctgaatattggtcgtatcagtttcccaagggcatttgggagcttgaa
agagtcagacggcgcgcagtagcttccatcgatcacgtacttgccgacacgctttccatc
agcggtggactcgatccaaccattcccgaagaggcttctgtgttggtgaccagcaaaccc
aaaggggtgaataagcatttgcatatcaagacaatcgggcatcttatgccctacgataag
aatattgatgcccagaatgaggctatggctgctgtggttgcttggatgcagggaaagcgc
tag

DBGET integrated database retrieval system