KEGG   Sphaerochaeta globosa: SpiBuddy_2178Help
Entry
SpiBuddy_2178     CDS       T01439                                 

Definition
tryptophan synthase beta chain (EC:4.2.1.20)
Orthology
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
sbu  Sphaerochaeta globosa
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sbu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SpiBuddy_2178
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SpiBuddy_2178
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SpiBuddy_2178
Enzymes [BR:sbu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SpiBuddy_2178
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2362368..2363651
Genome map
AA seq 427 aa AA seqDB search
MQNALTKEINTTNLPTKEGRFGEFGGSYIPPQLQAVMDEITQAYEQIVQDPAFLNELSDL
QKHYVGRPSPVYHAKRLSDAVGGAQIYLKREDLNHTGAHKINHCIGEVLLAKKLGKKKVI
AETGAGQHGVALATAAALMGLECDIYMGAVDIKKEAPNVSRMKILGATVVEVTRGTKTLK
DAVDAAFEAYLQDPVTQIYCIGSVVGPHPFPMMVRDFQSVVGIEARKQIQEMTGSLPDAI
VACVGGGSNAMGIFSAFLDDKLVKLYGVEPAGRGLDTPDHAATITKGSVGILHGFKSLLL
QDEKGEALPVYSIASGLDYPGVGPQHSYLHSIGRVIYDSATDREAVEAFYGLSRMEGIIP
ALESSHAVAHAIKLAQKMSKDEVILVNLSGRGDKDIDFVMEHYPLVEYEPQEGGDGFEEF
LAHIKQK
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgcagaacgcacttactaaagaaataaacacaaccaatcttcccaccaaggaaggacgc
ttcggagagtttggaggttcgtatatccctccccaattgcaagcagttatggacgagatc
acccaagcctatgagcagatagtccaagacccggcattcctgaatgaactctcagacctc
caaaaacactatgtcggccgcccttcgccggtctaccatgcgaagcgtctgtccgatgca
gttggtggagctcagatttaccttaagcgggaagacctgaaccataccggagcccataag
atcaaccactgcatcggagaggtgctgctcgccaaaaaactgggcaagaaaaaagtaatt
gctgagacaggcgccggtcaacacggtgttgcactcgccaccgccgctgcattgatgggt
ctggagtgtgacatttacatgggagcggttgacattaagaaagaggctccaaatgtaagc
cggatgaaaatcctcggtgctaccgtagtcgaggtaaccagagggaccaaaacgctcaag
gatgccgttgatgcagcctttgaagcctatctccaagaccctgtaacccagatttactgc
atcggctcggtagttggtccccatcccttccccatgatggtccgtgatttccaaagtgtg
gttggcatagaagcaagaaagcagattcaggagatgaccggctccctccctgatgcaatc
gtggcttgtgtcggcggaggttcaaatgccatgggcattttcagtgccttcctcgatgac
aaactggtcaagctctatggggttgaaccggccggaagaggcttggacactcccgatcat
gcagcaaccatcaccaagggtagtgttggcattctacatggattcaagagtctgctcctc
caggacgaaaagggagaagccttgccggtctattcaattgccagtggtctcgattacccg
ggtgttggaccacaacacagctacctgcacagcattggccgcgttatatacgatagtgct
accgaccgagaggcggtagaagctttctatggtttgagcaggatggagggcattatcccg
gctcttgaatccagccatgcagtagcccatgccattaagctggctcagaaaatgagtaag
gatgaggtcattttagtcaacctttcaggaaggggggacaaggacatagactttgtcatg
gagcactatcctttggtggagtatgaaccgcaggaaggtggtgatggatttgaggagttc
ctggcacatatcaagcagaagtaa

DBGET integrated database retrieval system