KEGG   Sphaerochaeta globosa: SpiBuddy_2178Help
Entry
SpiBuddy_2178     CDS       T01439                                 

Definition
(GenBank) Tryptophan synthase beta chain
  KO
K06001  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
sbu  Sphaerochaeta globosa
Pathway
sbu00260  Glycine, serine and threonine metabolism
sbu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sbu01100  Metabolic pathways
sbu01110  Biosynthesis of secondary metabolites
sbu01130  Biosynthesis of antibiotics
sbu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sbu00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SpiBuddy_2178
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SpiBuddy_2178
Enzymes [BR:sbu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SpiBuddy_2178
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP DFP DUF456
Motif
Other DBs
NCBI-ProteinID: ADY13997
JGI: SpiBuddy_2178
UniProt: F0RSU7
Position
2362368..2363651
Genome map
AA seq 427 aa AA seqDB search
MQNALTKEINTTNLPTKEGRFGEFGGSYIPPQLQAVMDEITQAYEQIVQDPAFLNELSDL
QKHYVGRPSPVYHAKRLSDAVGGAQIYLKREDLNHTGAHKINHCIGEVLLAKKLGKKKVI
AETGAGQHGVALATAAALMGLECDIYMGAVDIKKEAPNVSRMKILGATVVEVTRGTKTLK
DAVDAAFEAYLQDPVTQIYCIGSVVGPHPFPMMVRDFQSVVGIEARKQIQEMTGSLPDAI
VACVGGGSNAMGIFSAFLDDKLVKLYGVEPAGRGLDTPDHAATITKGSVGILHGFKSLLL
QDEKGEALPVYSIASGLDYPGVGPQHSYLHSIGRVIYDSATDREAVEAFYGLSRMEGIIP
ALESSHAVAHAIKLAQKMSKDEVILVNLSGRGDKDIDFVMEHYPLVEYEPQEGGDGFEEF
LAHIKQK
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgcagaacgcacttactaaagaaataaacacaaccaatcttcccaccaaggaaggacgc
ttcggagagtttggaggttcgtatatccctccccaattgcaagcagttatggacgagatc
acccaagcctatgagcagatagtccaagacccggcattcctgaatgaactctcagacctc
caaaaacactatgtcggccgcccttcgccggtctaccatgcgaagcgtctgtccgatgca
gttggtggagctcagatttaccttaagcgggaagacctgaaccataccggagcccataag
atcaaccactgcatcggagaggtgctgctcgccaaaaaactgggcaagaaaaaagtaatt
gctgagacaggcgccggtcaacacggtgttgcactcgccaccgccgctgcattgatgggt
ctggagtgtgacatttacatgggagcggttgacattaagaaagaggctccaaatgtaagc
cggatgaaaatcctcggtgctaccgtagtcgaggtaaccagagggaccaaaacgctcaag
gatgccgttgatgcagcctttgaagcctatctccaagaccctgtaacccagatttactgc
atcggctcggtagttggtccccatcccttccccatgatggtccgtgatttccaaagtgtg
gttggcatagaagcaagaaagcagattcaggagatgaccggctccctccctgatgcaatc
gtggcttgtgtcggcggaggttcaaatgccatgggcattttcagtgccttcctcgatgac
aaactggtcaagctctatggggttgaaccggccggaagaggcttggacactcccgatcat
gcagcaaccatcaccaagggtagtgttggcattctacatggattcaagagtctgctcctc
caggacgaaaagggagaagccttgccggtctattcaattgccagtggtctcgattacccg
ggtgttggaccacaacacagctacctgcacagcattggccgcgttatatacgatagtgct
accgaccgagaggcggtagaagctttctatggtttgagcaggatggagggcattatcccg
gctcttgaatccagccatgcagtagcccatgccattaagctggctcagaaaatgagtaag
gatgaggtcattttagtcaacctttcaggaaggggggacaaggacatagactttgtcatg
gagcactatcctttggtggagtatgaaccgcaggaaggtggtgatggatttgaggagttc
ctggcacatatcaagcagaagtaa

DBGET integrated database retrieval system