KEGG   Sphaerochaeta globosa: SpiBuddy_2178Help
Entry
SpiBuddy_2178     CDS       T01439                                 

Definition
(GenBank) Tryptophan synthase beta chain
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
sbu  Sphaerochaeta globosa
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sbu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SpiBuddy_2178
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SpiBuddy_2178
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SpiBuddy_2178
Enzymes [BR:sbu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SpiBuddy_2178
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2362368..2363651
Genome map
AA seq 427 aa AA seqDB search
MQNALTKEINTTNLPTKEGRFGEFGGSYIPPQLQAVMDEITQAYEQIVQDPAFLNELSDL
QKHYVGRPSPVYHAKRLSDAVGGAQIYLKREDLNHTGAHKINHCIGEVLLAKKLGKKKVI
AETGAGQHGVALATAAALMGLECDIYMGAVDIKKEAPNVSRMKILGATVVEVTRGTKTLK
DAVDAAFEAYLQDPVTQIYCIGSVVGPHPFPMMVRDFQSVVGIEARKQIQEMTGSLPDAI
VACVGGGSNAMGIFSAFLDDKLVKLYGVEPAGRGLDTPDHAATITKGSVGILHGFKSLLL
QDEKGEALPVYSIASGLDYPGVGPQHSYLHSIGRVIYDSATDREAVEAFYGLSRMEGIIP
ALESSHAVAHAIKLAQKMSKDEVILVNLSGRGDKDIDFVMEHYPLVEYEPQEGGDGFEEF
LAHIKQK
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgcagaacgcacttactaaagaaataaacacaaccaatcttcccaccaaggaaggacgc
ttcggagagtttggaggttcgtatatccctccccaattgcaagcagttatggacgagatc
acccaagcctatgagcagatagtccaagacccggcattcctgaatgaactctcagacctc
caaaaacactatgtcggccgcccttcgccggtctaccatgcgaagcgtctgtccgatgca
gttggtggagctcagatttaccttaagcgggaagacctgaaccataccggagcccataag
atcaaccactgcatcggagaggtgctgctcgccaaaaaactgggcaagaaaaaagtaatt
gctgagacaggcgccggtcaacacggtgttgcactcgccaccgccgctgcattgatgggt
ctggagtgtgacatttacatgggagcggttgacattaagaaagaggctccaaatgtaagc
cggatgaaaatcctcggtgctaccgtagtcgaggtaaccagagggaccaaaacgctcaag
gatgccgttgatgcagcctttgaagcctatctccaagaccctgtaacccagatttactgc
atcggctcggtagttggtccccatcccttccccatgatggtccgtgatttccaaagtgtg
gttggcatagaagcaagaaagcagattcaggagatgaccggctccctccctgatgcaatc
gtggcttgtgtcggcggaggttcaaatgccatgggcattttcagtgccttcctcgatgac
aaactggtcaagctctatggggttgaaccggccggaagaggcttggacactcccgatcat
gcagcaaccatcaccaagggtagtgttggcattctacatggattcaagagtctgctcctc
caggacgaaaagggagaagccttgccggtctattcaattgccagtggtctcgattacccg
ggtgttggaccacaacacagctacctgcacagcattggccgcgttatatacgatagtgct
accgaccgagaggcggtagaagctttctatggtttgagcaggatggagggcattatcccg
gctcttgaatccagccatgcagtagcccatgccattaagctggctcagaaaatgagtaag
gatgaggtcattttagtcaacctttcaggaaggggggacaaggacatagactttgtcatg
gagcactatcctttggtggagtatgaaccgcaggaaggtggtgatggatttgaggagttc
ctggcacatatcaagcagaagtaa

DBGET integrated database retrieval system