KEGG   Sphaerochaeta globosa: SpiBuddy_2238Help
Entry
SpiBuddy_2238     CDS       T01439                                 

Definition
L-fucose isomerase (EC:5.3.1.25)
Orthology
K01818  
L-fucose isomerase [EC:5.3.1.25]
Organism
sbu  Sphaerochaeta globosa
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sbu00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    SpiBuddy_2238
Enzymes [BR:sbu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.25  L-fucose isomerase
     SpiBuddy_2238
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2433567..2435393
Genome map
AA seq 608 aa AA seqDB search
MANISGMKNVGPEKRYASTLPKIGIRPVIDGRQRGVRESLEDQTMNMAKAAAKLISDNVF
HGTGERVECVIADTTIGRVRESADCAEKFAREGVAITLTVTPCWCYGTETFDIDPMTIKA
VWGFNGTERPGAVYLAAVLAAHTQKGLPAFGIYGRDVQDNSDTSIPDDVSEKILRFARAS
LAVATMRGKSYLSIGGMAMGIAGSLVDQDLLQSYLGMRTEAVDMCEIERRIAEEIYDPEE
YKKAIDWVRQNCTQAEDTVNAPEYRRSAEQLKKDWEYCTKMTMIGRDLMIGNENLKKLGF
REEALGHNALFAGFQGQRQWTDHWPNGDFMETMLTTSFDWNGIREPYIMATENDHLNGIS
MLFCKLLTNRAAIFSDVRTYWSPEAVQRVTGWKPEGLAKEGFIHLINSGATTLDAAGQMK
NEQGESEMKPFWEITEKDVQKTLENTRFSVANCGYFRGGGFSSTFLSEGGMPLTMVRVNL
VKGVGPVLQLAEGWTCEVPEKVFDTINKRTDQTWPTTWFVPRTNGKEGPFKDVYSVMANW
GANHGALSYGHFGADLITLCSMLRIPVCMHNVSEDQIFRPSAWSMLGMDKEGADFRACET
FGPLYGKY
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatatatctggaatgaaaaatgtgggaccagaaaaacgctacgcttccacactt
cccaaaattggaattaggcctgttattgacggacggcagagaggggttcgcgaatctctt
gaagatcagaccatgaacatggcaaaggctgccgccaaactgataagcgataatgtattt
cacggaaccggagagcgggtcgagtgcgtcattgccgacaccaccatcggtcgagtgcgt
gaaagtgccgattgtgcagaaaagtttgccagggagggagtcgctataacgttgaccgtc
accccttgctggtgctatggaaccgaaaccttcgacatcgatccgatgaccatcaaggct
gtctggggcttcaacggcaccgaacgccctggagcggtgtaccttgcagctgtgctggct
gcccatacgcagaaaggcctacccgctttcggcatctacggccgtgacgtacaggacaac
agcgacacatccatccccgatgacgtttctgagaaaatcctgcgattcgcccgtgcttcc
cttgccgtggcgaccatgcgcggcaagagctacctctccatcggtggcatggcaatgggc
attgccggttcgttggtagaccaggatctgttgcaaagctatttgggaatgagaacggaa
gccgtcgacatgtgcgagatcgaaaggcgcatcgccgaagagatctatgatcccgaagaa
tacaaaaaagccatcgactgggtaaggcagaactgcacccaggccgaggatacggtcaac
gcccccgagtaccgcagaagcgcagagcaactgaagaaggattgggagtactgcaccaag
atgaccatgatcggacgcgatctcatgatcgggaacgagaacctgaagaagcttggattc
cgagaagaagcgctcggccacaacgccctgtttgcaggcttccaaggccagaggcagtgg
accgaccattggccgaacggcgactttatggagaccatgctcaccaccagttttgactgg
aacggcattcgcgaaccgtacattatggctaccgagaacgaccacctcaacggtatcagc
atgctcttctgcaagctcttgaccaaccgtgcggcaatcttcagcgatgtgcgcacctac
tggagtcctgaagcagtacagcgggtgaccggatggaaacccgaaggtctagccaaggaa
ggcttcatccatctcatcaacagtggtgcaaccaccttggatgctgcaggtcagatgaag
aacgagcaaggtgaaagtgaaatgaagcccttctgggaaatcaccgagaaagatgtacaa
aagacccttgagaatacccgcttcagcgttgcaaactgcggctatttccgcggcggcggc
ttcagctcaaccttcctcagcgaaggcggtatgcctctgaccatggttcgcgtcaatctt
gtgaagggagttggtccggttctgcagttggcggaaggctggacctgcgaagtccctgaa
aaggtatttgacaccatcaacaagagaaccgaccagacctggccgaccacgtggttcgtc
ccccggacgaatggcaaggaaggtccgttcaaggatgtgtactcggtgatggcaaactgg
ggagccaaccacggcgcgctcagttacggacacttcggcgccgatttgatcaccctctgc
tcaatgctgcgcatacccgtatgcatgcataacgtgagtgaggaccaaatcttccgtccc
agcgcctggtcgatgctcggtatggacaaggaaggagcagatttccgcgcctgcgaaacc
tttggccctctgtacggcaagtattga

DBGET integrated database retrieval system