KEGG   Sphaerochaeta globosa: SpiBuddy_2294Help
Entry
SpiBuddy_2294     CDS       T01439                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
sbu  Sphaerochaeta globosa
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbu00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    SpiBuddy_2294
Enzymes [BR:sbu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     SpiBuddy_2294
Exosome [BR:sbu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SpiBuddy_2294
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2492690..2494204)
Genome map
AA seq 504 aa AA seqDB search
MKYVGALDQGTTSTRFIVFDQKGTLVASHQLEHQQIYPQPGWVEHDPWEIWDNSSECISK
ALKAANLKGSDIAGIGITNQRETIIAWNPKTGKVWHNAIVWQDLRGSDLIEKLKEHVDAS
FLQKKSGLLFSPYFSASKIAWLLDHVDGLRDEAEKGDVVFGTIDTWLTWNLTGGKALVTD
VTNASRYLLMNIETCQWDDELLSLFNIPKKALPMIVPSSGMVYATTTPSGPLRSEVPVCG
ILGDQQAALFGQACFTEGLGKSTYGTGCFLLVNTGLKLVTSAQGLLTTVAYQLGSEKPMY
ALEGSIAVAGSLVQWARDNLKIVQNPQELDKLASSVPDCGGVYIVPAFSGLFAPYWRSDA
RGVIAGLTGYVTRAHLARAILEATAFQAHDIFKGMEKDSGIEMTTLKVDGGLTNSQPLME
FQADLLGIPVIRPLVVETTALGAAYAAGLSVGVWKDLQELAAYWKEERRWEPKMSKEVRC
EKIRFWKKAVNRTLDWVGPQEDEQ
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
gtgaaatacgttggagctttggaccaggggacgaccagtacccgatttattgtatttgat
cagaaagggactcttgtcgcatcccatcagctggaacaccagcagatttatccccagccc
ggttgggtcgaacatgatccttgggaaatctgggacaacagctcggagtgcatcagcaag
gccctcaaggctgccaacctcaaaggcagcgatattgcaggaatcggcatcaccaaccag
cgggagaccatcatcgcttggaatccgaagactggaaaagtctggcacaatgccatcgta
tggcaggacctgaggggttccgacctcattgagaagctgaaagagcatgtggatgcttct
tttttgcagaaaaagagcggtctgcttttcagcccgtatttttctgcttccaaaattgct
tggttgcttgaccatgtggatggtctgcgtgatgaggccgagaagggcgatgtggtcttc
ggcaccatcgatacctggcttacctggaaccttaccggtggaaaagcactggttaccgat
gtgaccaatgcttcacgataccttttgatgaatatcgagacctgtcagtgggatgacgag
ctgctctccctgttcaatatacccaagaaagctcttcctatgattgttccgtcatcgggc
atggtgtatgccactaccacccccagcggtccgcttcgcagcgaagttcctgtgtgtgga
atcctcggcgaccagcaggctgccttgttcggccaggcctgtttcacggaaggattggga
aagagcacgtacggtaccggctgcttccttttggtaaacaccggactcaagcttgtcacc
agtgcccaaggtttgttgacaaccgtggcctatcagctgggcagtgaaaagccgatgtac
gcattggaaggttccattgcagtagcaggctccttggttcaatgggcacgggacaatttg
aagatcgtgcagaatccacaggaactggacaaactggcctcctctgtgccagactgcggc
ggagtgtacatcgttcctgctttcagtgggctttttgctccgtactggagatctgatgca
cgcggggtaattgcagggctgaccggctatgtgacccgcgcccaccttgccagggccatt
ttggaagcgacagccttccaagcccacgatattttcaagggaatggaaaaggatagcgga
atcgagatgactaccctcaaggtcgacggcgggcttaccaacagccagccattgatggaa
ttccaagccgacctgctggggattcctgtcatccgtcccttggtggtggagactactgct
ttgggtgccgcctacgctgcgggcttgtctgtgggagtatggaaggatttacaggagctt
gccgcctattggaaggaggagcgccgttgggaaccgaagatgtccaaggaagttcgatgt
gagaagattcgcttctggaagaaagctgtgaatcgcaccctcgactgggtggggccgcag
gaagatgaacagtag

  All links  
No link information was found.   
DBGET integrated database retrieval system