KEGG   Sphaerochaeta globosa: SpiBuddy_2458Help
Entry
SpiBuddy_2458     CDS       T01439                                 

Definition
sucrose phosphorylase (EC:2.4.1.7)
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
sbu  Sphaerochaeta globosa
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:sbu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SpiBuddy_2458
Enzymes [BR:sbu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     SpiBuddy_2458
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2668195..2669646)
Genome map
AA seq 483 aa AA seqDB search
MSQKITNRIMLITYPDCFGQGLKDLRMVLDTDFKGLFGGLHILPFFPSTADRGFSPTTYT
EVDPRFGDWDDIMALGEQYYLMYDYMINHLSSESDAFKDFVEKKDASLYRDFFIRYKDFW
SNGEPTKQDLERMYRRKQIPWITVQFNDGSQEKLWTTFSDYQVDINQNSRVAKQFHADTI
SFLASHGGTLIRLDAVAYAAKREGTSCFFAEPEIWELLQQCADVLKGSNSVVLPEIHENY
FLQQKVEENGYYVYDFQLPMLVLNALYFGKSRYLKNWLRICPRKQFTTLDTHDGIGVVDA
RYLMPDEELLATRRRCFEMNPDVYAMYAHSGIKIDLDAFDTYQINCTYYSACGADDWQYY
IARAIQFFAPGIPQVYYVGLLAGENDFELYNQTQQNRDVNRSYYSLLDVKENMKRPIVQK
LMRLMAFRNTHPAFNGDFEVLPSGVSELDLCWRNGSEYAILYVDFSTFECSIVYTEQGVE
KEL
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaaaaaatcacaaatcgaatcatgttgattacgtatcctgattgttttggccag
ggcctgaaggacttgagaatggttctggataccgatttcaaagggttgttcggaggactt
catatccttccgtttttcccttctaccgctgatcgaggattctctccgaccacctataca
gaagtggatccacggttcggcgattgggacgatatcatggcactgggcgagcagtattac
ctgatgtacgactatatgattaatcatctgtcatcggaaagtgatgcattcaaggatttt
gttgagaagaaagacgcctcgctgtatcgcgatttctttatccgatataaagacttttgg
tcgaatggggagccgacaaaacaagatctggaaaggatgtaccgccggaaacagattccc
tggattactgttcagttcaacgatgggtcacaagagaagttgtggacgacgttcagcgac
taccaggtagacatcaatcaaaattcacgagttgccaagcaatttcatgcggacactatt
tcatttcttgcttcccatggcggtaccttgattcgcctcgatgcggttgcctatgcggca
aagagggagggtactagttgcttttttgcagagccggaaatttgggaattgctacagcag
tgtgctgatgtattgaaaggttcaaattccgttgtgcttcctgaaatccatgagaattat
ttcttgcaacagaaagtcgaggagaatggctactatgtatacgatttccaactcccgatg
cttgttctgaatgcgctctatttcggtaaaagccgatatctgaagaactggttgaggatt
tgcccgagaaagcaattcacgacattggatacccacgatgggatcggggtggtggatgct
cgatatctcatgccggatgaggagttgcttgccacccgcaggcggtgtttcgagatgaat
cccgatgtatatgcaatgtatgcacattcaggaataaagattgatttagatgcgttcgat
acgtatcagatcaactgtacctattattctgcctgcggtgcggatgactggcagtattat
attgcccgcgctattcaatttttcgcccctggtattcctcaagtgtattatgtcgggctt
cttgctggggagaatgattttgagctctacaaccagacacaacagaatcgtgatgtgaac
cggtcgtattattctttgctggatgtgaaagagaacatgaagcgaccgattgtgcagaaa
ctgatgcgcctgatggcctttcggaacacgcatcctgccttcaacggtgattttgaagtg
ctcccatctggtgtatctgaactagatctctgttggagaaatggttcagagtatgcaata
ttgtatgttgatttctcgacgttcgaatgttcaattgtctatacagaacagggtgttgag
aaagagctgtga

DBGET integrated database retrieval system