KEGG   Spirochaeta sp. Buddy: SpiBuddy_2734Help
Entry
SpiBuddy_2734     CDS       T01439                                 

Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
sbu  Spirochaeta sp. Buddy
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:sbu00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:sbu00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:sbu00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2968581..2969936
Genome map
AA seq 451 aa AA seqDB search
MKIVLVGAGSIQFGLGTLGDIFTSTTLKGSEITLLDINANALDVVLQTTKDFIQAHKLVY
TVNATTDRRKAFQGADFIISSIEVGNRFQMWDEDWKIPLQYGVHQVYGENGGPGGVFHSL
RIGRVILDIVKDAMEICPNAWIFNYSNPMTAICTTVKRMYPEAKFVGMCHEIGWLGRWLP
RMLNRDLKDLHYRAAGLNHFSCMLSLTDRKTGKDLYPEVLEKAEAFFEREPGYSDLYDAY
RKTGTLDAAEKFEKEAVSQKSAYEWADRRLVQFMLKNYHLLPITTDSHFGEYLSWAWDIV
DHRGILDFYDVYKVMLSQEVPHEIRLETSERVIPIIDGILGDANYEEAAVNIQNNGLIAD
LPSWLVVEVPAMINKTGVNGIKMDGMPKGFLALLRSYAGVYDLTAEAIIHRKKEYAIQAL
LANPVVNQASSLEALLDRMISKQEKWLGYLQ
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattgttctggttggcgctgggagtatccagttcggattaggtacactcggggat
attttcaccagtactacgctgaagggtagtgaaataaccttgctcgacatcaatgcaaac
gcattggacgtagtgctgcaaacaacaaaggattttatccaggcacacaaacttgtgtat
acggtgaatgccaccaccgaccgcagaaaggctttccaaggggccgatttcatcatcagc
tcaattgaagtcggaaacagattccagatgtgggacgaggactggaaaatacccctgcag
tacggggtgcatcaggtgtacggggagaatggcggaccgggcggcgttttccattccctt
cgcataggcagggtgattcttgacattgtcaaggatgccatggaaatctgccccaacgca
tggattttcaattactccaatccgatgaccgccatatgcacaacggtcaagcggatgtat
cccgaggcaaaattcgtaggaatgtgccacgaaatcggctggttgggacgttggctgccc
cgcatgctcaatagggatctaaaggacctgcactatagagccgcaggcttgaaccatttc
agttgcatgctctccctcaccgaccgaaaaaccggcaaggacctgtatccggaagtgtta
gagaaagctgaagctttcttcgaacgtgaacctggatatagtgacttgtacgatgcatac
cggaaaaccggcacgctcgatgcggctgagaaattcgagaaggaagcagtaagccagaag
agtgcctatgaatgggcggatcgtcgcttggtgcagttcatgcttaagaactaccatttg
ctgcccatcacaaccgatagtcatttcggtgagtatctgagctgggcttgggatatagtc
gaccataggggcatcctcgatttctacgatgtctacaaagtcatgctgtcccaggaagtc
ccccacgaaatccgtttggagacttccgaacgggttattccgatcatcgacgggattctc
ggtgatgcaaactatgaggaagctgctgtcaacatccagaacaatgggcttatcgccgat
ctgccatcctggttggttgttgaggttcctgccatgatcaacaagacgggagtgaatggg
atcaaaatggatggaatgcccaaaggctttttggcattgctccgttcgtacgccggtgtg
tatgacttgaccgccgaggcgatcatacacaggaaaaaagaatatgccatccaggccttg
ctggcaaacccagtggtgaaccaggcctcgtcactagaggcattgctcgatcggatgatc
agcaagcaggaaaagtggttgggatatttgcagtaa

DBGET integrated database retrieval system