KEGG   Sphaerochaeta globosa: SpiBuddy_2734Help
Entry
SpiBuddy_2734     CDS       T01439                                 

Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
sbu  Sphaerochaeta globosa
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:sbu00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SpiBuddy_2734
  Lipid metabolism
   00561 Glycerolipid metabolism
    SpiBuddy_2734
   00600 Sphingolipid metabolism
    SpiBuddy_2734
Enzymes [BR:sbu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     SpiBuddy_2734
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2968581..2969936
Genome map
AA seq 451 aa AA seqDB search
MKIVLVGAGSIQFGLGTLGDIFTSTTLKGSEITLLDINANALDVVLQTTKDFIQAHKLVY
TVNATTDRRKAFQGADFIISSIEVGNRFQMWDEDWKIPLQYGVHQVYGENGGPGGVFHSL
RIGRVILDIVKDAMEICPNAWIFNYSNPMTAICTTVKRMYPEAKFVGMCHEIGWLGRWLP
RMLNRDLKDLHYRAAGLNHFSCMLSLTDRKTGKDLYPEVLEKAEAFFEREPGYSDLYDAY
RKTGTLDAAEKFEKEAVSQKSAYEWADRRLVQFMLKNYHLLPITTDSHFGEYLSWAWDIV
DHRGILDFYDVYKVMLSQEVPHEIRLETSERVIPIIDGILGDANYEEAAVNIQNNGLIAD
LPSWLVVEVPAMINKTGVNGIKMDGMPKGFLALLRSYAGVYDLTAEAIIHRKKEYAIQAL
LANPVVNQASSLEALLDRMISKQEKWLGYLQ
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattgttctggttggcgctgggagtatccagttcggattaggtacactcggggat
attttcaccagtactacgctgaagggtagtgaaataaccttgctcgacatcaatgcaaac
gcattggacgtagtgctgcaaacaacaaaggattttatccaggcacacaaacttgtgtat
acggtgaatgccaccaccgaccgcagaaaggctttccaaggggccgatttcatcatcagc
tcaattgaagtcggaaacagattccagatgtgggacgaggactggaaaatacccctgcag
tacggggtgcatcaggtgtacggggagaatggcggaccgggcggcgttttccattccctt
cgcataggcagggtgattcttgacattgtcaaggatgccatggaaatctgccccaacgca
tggattttcaattactccaatccgatgaccgccatatgcacaacggtcaagcggatgtat
cccgaggcaaaattcgtaggaatgtgccacgaaatcggctggttgggacgttggctgccc
cgcatgctcaatagggatctaaaggacctgcactatagagccgcaggcttgaaccatttc
agttgcatgctctccctcaccgaccgaaaaaccggcaaggacctgtatccggaagtgtta
gagaaagctgaagctttcttcgaacgtgaacctggatatagtgacttgtacgatgcatac
cggaaaaccggcacgctcgatgcggctgagaaattcgagaaggaagcagtaagccagaag
agtgcctatgaatgggcggatcgtcgcttggtgcagttcatgcttaagaactaccatttg
ctgcccatcacaaccgatagtcatttcggtgagtatctgagctgggcttgggatatagtc
gaccataggggcatcctcgatttctacgatgtctacaaagtcatgctgtcccaggaagtc
ccccacgaaatccgtttggagacttccgaacgggttattccgatcatcgacgggattctc
ggtgatgcaaactatgaggaagctgctgtcaacatccagaacaatgggcttatcgccgat
ctgccatcctggttggttgttgaggttcctgccatgatcaacaagacgggagtgaatggg
atcaaaatggatggaatgcccaaaggctttttggcattgctccgttcgtacgccggtgtg
tatgacttgaccgccgaggcgatcatacacaggaaaaaagaatatgccatccaggccttg
ctggcaaacccagtggtgaaccaggcctcgtcactagaggcattgctcgatcggatgatc
agcaagcaggaaaagtggttgggatatttgcagtaa

DBGET integrated database retrieval system