KEGG   Sphaerochaeta globosa: SpiBuddy_2949Help
Entry
SpiBuddy_2949     CDS       T01439                                 

Definition
(GenBank) class II aldolase/adducin family protein
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
sbu  Sphaerochaeta globosa
Pathway
sbu00051  Fructose and mannose metabolism
sbu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sbu00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    SpiBuddy_2949
Enzymes [BR:sbu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     SpiBuddy_2949
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: ADY14756
JGI: SpiBuddy_2949
UniProt: F0RZK5
Position
complement(3194708..3195373)
Genome map
AA seq 221 aa AA seqDB search
MDIKQFEQQRRQVASFMTRLYDRQLTTASGGNISLRISEDLFCITPSALDKGLLTFEDIA
VVTLEGKNLTPHLRLSIETEMHRLILISRPDCKAIVHAHPTYVSAFTAIQKDGKCAINTH
LIAESYYILEDPILVEYRLMGTVNLAEIAAVKAFDHDVLLLENHGAVTLGHSMLEAFDKI
ELLERAAQMTVVTEQMAAAGYAVSPLADPRLKQLMQMKYQK
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atggatatcaaacaattcgaacaacaacggcggcaagtcgcttctttcatgacgcgcttg
tacgaccgacagcttactacggcaagtggtgggaatatcagcttgaggatcagtgaggac
cttttctgcattaccccttcagctttggacaaaggtctgctcacctttgaggatatcgca
gtggtcacccttgagggaaagaacctcacaccccacttgcgtttgagcatagaaacagag
atgcatcgcctgattctcatctcccgccccgactgcaaggcgattgttcatgcccatcct
acctatgtatcggcatttacagccattcagaaggatgggaagtgtgcgatcaacacccac
ctgatcgctgaatcctattacattctggaggatccaattctggtcgagtaccgtctgatg
gggaccgtcaatcttgctgagattgcagcggtaaaggccttcgaccatgatgtgttgctc
ttggaaaaccatggtgccgttacgcttgggcactcgatgctcgaggctttcgataaaatc
gaattgctcgaacgtgctgcccaaatgactgttgttaccgagcagatggcagctgcaggc
tacgctgtttctcccttggctgacccccgtctgaagcagctgatgcagatgaaataccaa
aagtag

DBGET integrated database retrieval system