KEGG   Sphaerochaeta globosa: SpiBuddy_3038Help
Entry
SpiBuddy_3038     CDS       T01439                                 

Definition
recombination protein recR
Orthology
K06187  
recombination protein RecR
Organism
sbu  Sphaerochaeta globosa
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sbu00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SpiBuddy_3038
DNA repair and recombination proteins [BR:sbu03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      SpiBuddy_3038
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3291245..3291835
Genome map
AA seq 196 aa AA seqDB search
MTALENLIQTLSRLPGIGPKSASRLAYHLIKTDKLYNSTLADAIATIQDKIFPCSICGSF
TEYDPCPMCGDTSRDRTQLCVVEQPQDVLTLQSSGAYNGLYHVLGGAISPLDGIGPEHLS
FSKLVKRIDEGGFTELIIATNPTEEGDTTALYLRHILKNHEELSITRLASGLPIGGDLEY
ADRITLARSLRGRVRF
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgacagcccttgagaatctcatccaaaccctttcacgactgcccggcatcggcccgaag
agtgcctcgcgtcttgcatatcatctgatcaagacggacaagctgtacaacagcacactc
gctgatgcgattgcgaccatccaggacaaaattttcccttgttccatttgcggcagcttt
accgagtatgatccgtgcccgatgtgtggtgataccagtcgcgaccgcacccaactgtgt
gtggtcgagcaaccacaggatgtgctcaccttgcaatcaagtggagcctacaacggctta
taccatgttctgggaggggccattagcccgctggacggcatcggacctgaacacttatca
ttttccaaactggtgaagcgcatcgatgaaggtggattcactgaactgattatcgcaacc
aaccccaccgaagagggagatacaaccgccttgtacctcaggcatatcctgaagaatcat
gaagagctctccatcacccgtctggccagtggactccccatcggcggcgatcttgaatat
gcagatagaatcactcttgcccgttcgctcaggggaagagtcagattctag

DBGET integrated database retrieval system