KEGG   Salmonella bongori N268-08: A464_1546Help
Entry
A464_1546         CDS       T02733                                 

Definition
Glutaminase
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
sbz  Salmonella bongori N268-08
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbz00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    A464_1546
   00330 Arginine and proline metabolism
    A464_1546
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    A464_1546
Enzymes [BR:sbz01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     A464_1546
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1543295..1544221
Genome map
AA seq 308 aa AA seqDB search
MARTMDNAILETILQRVRPLIGQGKVADYIPALASVEGAKLGIAICTVDGQHYQAGDAHE
RFSIQSISKVLSLVVAMRHYQEEEIWQRVGKDPSGSPFNSLVQLEMEQGIPRNPFINAGA
LVVCDMLQGRLSAPRQRMLEIVRALCGVSDITYDSTVARSEFEHSARNAAIAWLMKSFGN
FHHDVPTVLQNYFHYCALKMSCMELARTFVFLANQGKAFHLDEPVVTPMQARQINALMAT
SGMYQNAGEFAWRVGLPAKSGVGGGIVAIVPHEMAIAVWSPELDPAGNSLAGIAALEQLT
QTLGRSVY
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
gtggccaggaccatggacaatgcaattttagagacgattttacagcgcgttcgccccctg
attggtcaggggaaagttgctgactatatcccggcattagcgtctgtcgagggggcaaag
ctgggaatagcgatttgtactgtggatgggcagcattaccaggcgggcgatgcgcacgag
cgcttttctattcagtctatatcgaaagtgctgagtctggtggtggcgatgcgtcattat
caggaagaggagatctggcagcgtgtcggaaaagatccttccggctcgccgttcaattcg
ctggttcagttagagatggaacaaggcattccgcgtaatccttttattaatgcgggtgcg
ctggtggtatgcgacatgttgcaaggacggcttagtgcgccgcgtcagcggatgcttgag
attgtgcgtgcgttatgcggcgtatcagatatcacatatgattctacggttgctcgctct
gagtttgagcattccgcccgtaatgccgctattgcctggctgatgaagtcatttggtaac
tttcatcatgatgtgcccaccgttctgcaaaattacttccactattgcgcgttaaaaatg
agttgtatggagctggcgagaacatttgtctttctggctaatcagggaaaggcatttcat
ctcgacgaaccggtagtaacgcccatgcaggccaggcaaattaacgccctgatggcgacc
agtggtatgtatcagaacgccggggaatttgcctggcgtgtggggttgccagccaagtct
ggggtgggaggcggtattgtcgccattgtgccgcatgaaatggcgattgccgtctggagt
ccggagctggatcctgcgggaaactctctggcaggtattgccgcgcttgaacaattaaca
caaacgttaggacgttcggtatactga

DBGET integrated database retrieval system