KEGG   Salmonella bongori N268-08: A464_197Help
Entry
A464_197          CDS       T02733                                 

Definition
Multimodular transpeptidase-transglycosylase
Orthology
K05365  
penicillin-binding protein 1B [EC:2.4.1.129 3.4.-.-]
Organism
sbz  Salmonella bongori N268-08
Pathway
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:sbz00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    A464_197
Enzymes [BR:sbz01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     A464_197
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.-  Acting on peptide bonds (peptidases)
    3.4.-.-  
     A464_197
Glycosyltransferases [BR:sbz01003]
 Polysaccharide
  Bacterial polysaccharide
   A464_197
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
206271..208793
Genome map
AA seq 840 aa AA seqDB search
MAGNDREPIGRKGKPSRPVKQKVSRRRQYDDDYDDDYEDEKPMPRKGKGKGRKPRGKRGW
LWLLLKLFIVFVVLFAIYGVYLDQKIRSRIDGKVWQLPAAVYGRMVNLEPDMPVSKNEMV
KLLEATQYRLVTKMTRPGEFTVQANSIEMIRRPFDFPDSKEGQVRARLTFDDGRLETIVN
LDNNRQFGFFRLDPRLITMLSSPNGEQRLFVPRSGFPDLLVDTLLATEDRHFYEHDGISL
YSIGRAVLANLTAGRTVQGASTLTQQLVKNLFLSSERSYWRKANEAYMALIMDARYSKDR
ILELYMNEVYLGQSGDNEIRGFPLASLYYFGRPVEELSLDQQALLVGMVKGASIYNPWRN
PKLALERRNLVLRLLQQQKIIDQELYDMLSARPLGVQPRGGVISPQPAFMQMVRQELQAK
LGDKIKDLSGVKIFTTFDSVAQDAAEKAVVEGIPALKKQRKLSDLETAMVVVDRFSGEVR
AMVGGAEPQYAGYNRAMQARRSIGSLAKPATYLTALSQPNLYRLNTWIADAPISLRQPNG
QVWSPQNDDRRYSESGKVMLVDALTRSMNVPTVNLGMALGLPAVTDTWTKLGVPKDQLNP
VPAMLLGALNLTPIEVAQAFQTIASGGNRAPLSALRSVIAEDGKVLYQSYPQAERAVPAQ
AAYLTLWTMQQVVQRGTGRQLGAKYPGLHLAGKTGTTNNNVDTWFAGIDGSQVTITWVGR
DNNQPTKLYGASGAMAIYQRYLANQTPTPLVLTPPEDVVDMGVDYDGNFVCSGGMRTLPV
WTDDPNTLCQQGEMMQQQQPSGNPFDQSSQPQQQPAQQQPPKEEKSDGVAGWIKEMFGGN
NT seq 2523 nt NT seq  +upstreamnt  +downstreamnt
atggcggggaatgaccgcgagccgattggacgtaaagggaaaccgtcgcgtcctgtgaaa
caaaaagtgagccgtcgtcggcagtatgacgacgattatgatgacgactatgaggatgaa
aaaccgatgccgcgtaaaggtaagggcaaagggcgtaagcctcgtggcaagcgcggctgg
ctatggctattgctaaaactgtttatcgtttttgtggtgttgttcgccatttacggtgtt
tatctggatcaaaaaatccgcagccgtattgatggcaaggtctggcagcttcccgcggcg
gtatatggccggatggtgaaccttgagccggacatgcctgtcagcaaaaacgagatggtg
aaattgctggaagcgacgcagtatcgtctggtgacaaagatgacgcgtcccggcgaattt
accgtgcaggccaatagcattgagatgatccgtcgtccgtttgacttcccggacagcaaa
gaaggacaggtgcgcgcgcggctgacgttcgatgacggacgtctggaaaccatcgtcaat
ctggataataaccgccagtttggcttcttccgcctcgatccgcgactcatcactatgctt
tcttcgccaaacggcgagcagcgtctgtttgtaccgcgtagcggcttcccggatctgctg
gttgataccctgctggcaaccgaagaccgtcatttttatgagcatgacgggatcagcctg
tactcgattggccgtgccgtgttagcgaacctgaccgcggggcgtacagtacagggggcc
agtaccctgacgcagcagttggtgaaaaacctgttcctttccagcgagcgttcatactgg
cgcaaggcgaatgaagcctacatggcgctgattatggatgcccgctacagtaaagatcgt
attcttgaactgtatatgaacgaggtctatctcggacagagcggcgataacgagattcgt
ggtttcccgctggcgagcctgtactattttggccgtccggtggaagaactgagccttgac
cagcaggcgctgctggtggggatggtaaaaggggcgtcgatttataatccgtggcgcaac
ccgaaactggcgctggagcgccgtaacctggtgttacgcctgttgcagcagcagaaaatt
atcgatcaggagctctatgacatgctgagcgcccgtccgcttggcgtacagccacgcggc
ggcgtgatttcaccgcagccggcgtttatgcagatggttcgccaggagttacaggcgaag
ctgggggataaaattaaagatctctccggcgtgaagattttcaccacctttgactctgtg
gcgcaggatgccgcagagaaagcggttgtggaaggtattccggcgttgaagaagcagcgt
aagttgagcgatctggaaacggcgatggtggtagtggatcgctttagcggcgaggtgcgc
gcaatggtcggcggggcggaaccgcagtatgctggctataaccgcgctatgcaggcgcgc
cgttccatcgggtcgctggcgaaaccagccacctatctgacggcgttaagccagcctaac
ttatatcgtctgaatacctggattgccgatgcgccgatttcactacgccagccgaacgga
caggtttggtcgccgcagaacgacgatcgtcgctacagcgaaagtgggaaagtgatgctg
gtggatgcgctaacccgctcgatgaacgtgccgacggtaaatctggggatggcgttaggc
ttaccggcggttaccgatacctggactaagctcggcgtgccgaaagatcagctcaatccg
gttccggctatgctgttaggggcgctgaatctgacgccgattgaggttgcgcaagcgttt
cagaccatcgccagcggtggtaatcgtgcgccgttatcagcgctgcgttcggttattgcg
gaagatggtaaagtgctgtaccaaagttatccgcaagctgaacgcgccgtaccggcacag
gcggcttacctgacgctctggacaatgcagcaggtcgtccagcgtgggacagggcgtcag
cttggtgcgaagtatccgggtctgcatctggcgggtaaaaccgggacgacaaacaacaat
gtcgatacctggtttgccggtatcgatggcagccaggtgaccatcacctgggtaggccgt
gataacaaccagccgacgaagctgtacggcgccagcggcgcgatggcgatttaccagcgc
tatctggcaaatcagacgccgacgcctttagtgctgacgccgccggaagatgtggtggat
atgggcgtggactacgacggtaattttgtctgcagcggcggaatgcgaactctgccggtc
tggacggacgatccaaatacgctgtgccagcagggcgagatgatgcagcaacagcagcca
tcaggtaatccgtttgatcagtcatctcaaccgcagcagcagcctgcgcagcaacagccg
ccaaaagaagagaaaagcgacggcgttgccggctggattaaggagatgtttggcggcaat
taa

DBGET integrated database retrieval system