KEGG   Salmonella bongori N268-08: A464_2446Help
Entry
A464_2446         CDS       T02733                                 

Definition
Aspartate/tyrosine/aromatic amino transferase
Orthology
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
sbz  Salmonella bongori N268-08
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; 2-Oxocarboxylic acid metabolism [PATH:sbz01210]
Metabolism; Overview; Biosynthesis of amino acids [PATH:sbz01230]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:sbz00250]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine biosynthesis [PATH:sbz00290]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2432329..2433543
Genome map
AA seq 404 aa AA seqDB search
MSPIEKSSKLENVCYDIRGPVLKEAKRLEEEGNKVLKLNIGNPAPFGFEAPDEILVDVIR
NLPTAQGYCDSKGLYSARKAIMQHYQARGMRDVTVEDIYIGNGVSELIVQAMQALLNSGD
EMLVPAPDYPLWTAAVSLSGGNAVHYLCDESSDWFPDLDDIRAKITPRTRGIVIINPNNP
TGAVYSKELLMEIVSIAREHNLIIFADEIYDKILYDDAEHHSIAALAPDLLTVTFNGLSK
TYRVAGFRQGWMVLNGPKKHAKGYIEGLEMLASMRLCANVPAQHAIQTALGGYQSISEFI
LPGGRLYEQRNRAWELINDIPGVSCVKPRGALYMFPKIDAKRFTIHDDQKMVLDFLLQEK
VLLVQGSAFNWPWPDHFRIVTLPREDDLEMAINRFGRFLSGYHQ
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgtcccccattgaaaaatccagcaaactcgaaaatgtctgttatgacatacgtggcccc
gttctgaaagaagcgaaacgcctggaagaagaaggtaataaagttcttaaactgaatatc
ggtaaccccgcccccttcggattcgaagcgccggacgaaattctggtcgatgtcattcgt
aatctgccgacagcgcaaggctattgcgactcgaaagggctctattccgcccgtaaagca
attatgcagcattaccaggcccggggaatgcgcgatgtgaccgtggaagatatttatatt
ggtaatggtgtttccgaactgatcgttcaggcgatgcaagcgttgcttaacagcggcgat
gaaatgctggttcctgcgcccgattatccgttgtggacagcagcggtatcgctctccggc
ggtaacgcagtacactatctttgtgatgaatcttccgactggttcccggaccttgacgat
atccgcgccaaaattaccccgcgtacgcgtggcattgtgattattaatccaaacaaccct
accggcgccgtttattctaaagaattgttgatggaaattgttagcattgcgcgcgagcat
aatctcatcatcttcgccgatgaaatttatgacaagatcctctacgacgatgccgaacat
cactccatcgccgcactggcgccggacctgttgaccgtcacctttaatggtttgtctaaa
acctatcgtgttgccggttttcgccagggctggatggtattaaacgggcctaaaaaacat
gcgaagggttatatcgaaggcctggagatgttggcttcaatgcgcctgtgcgccaatgtc
ccggcgcaacatgccattcagaccgcgctcggcggttatcaaagcattagtgaatttatc
ctgcctggtggccgtctgtatgaacagcgtaaccgcgcctgggagttgattaacgatatt
cccggcgtctcctgtgtaaaaccgcgcggcgcgttatacatgttcccgaagatcgacgct
aaacgctttactatccatgatgaccagaagatggtgctggatttcctgctacaggaaaaa
gtgctactggtgcaaggcagcgcctttaactggccgtggccggaccacttccgtattgtg
acactaccgcgtgaagatgacctagagatggctatcaaccgctttgggcgttttctctca
ggctaccatcaataa

DBGET integrated database retrieval system