KEGG   Salmonella bongori N268-08: A464_278Help
Entry
A464_278          CDS       T02733                                 

Definition
Glutamate 5-kinase, RNA-bindingC-terminal domain PUA
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
sbz  Salmonella bongori N268-08
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:sbz01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:sbz00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
299745..300848
Genome map
AA seq 367 aa AA seqDB search
MSDSQTLVVKLGTSVLTGGSRRLNRAHIVELVRQCAQLHAAGHRIVIVTSGAIAAGREHL
GYPELPATIASKQLLAAVGQSRLIQLWEQLFSIYGIHIGQMLLTRADMEDRERFLNARDT
LRALLDNHIVPVINENDAVATAEIKVGDNDNLSALAAILAGADKLLLLTDQQGLFTADPR
SNPLAELIKDVYGVDDALRSIAGDSVSGLGTGGMGTKLQAADVACRAGIDTIIASGSKPG
VIGDVMEGISVGTRFHAQASPLENRKRWIFGAPPAGEVTVDEGATAAMLERGSSLLPKGI
KSVTGNFSRGEVIRICNQEGRDIAHGVSRYNSDALRRIAGHHSQQIDAILGYEYGPVAVH
RDDMITR
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacagccagacgctggtggtaaaacttggtaccagcgtgctaacaggcggatcg
cgccgcctgaaccgtgcccatatcgtagaacttgtccgccagtgcgcgcagctacacgcc
gcgggacatcgcattgttattgttacttctggcgcgattgccgccggacgtgaacacttg
ggctacccggaacttccggccacgatcgcctctaaacagcttcttgcggcggtaggacaa
agccgtctgattcaactgtgggaacagttgttttcgatttacggtatccacattgggcag
atgctgctgacacgtgcggatatggaagacagagaacgttttctgaacgcccgcgatacg
ctgcgtgcgttactggataaccatattgtgccggttatcaatgaaaatgatgccgttgcg
acagcggaaattaaagtgggcgataacgataacctatccgcgctggcggcgatcctggca
ggagcggataaactgctgctgctgaccgatcagcaagggttatttaccgccgatccgcgt
agcaatccgctggcggagcttatcaaagacgtatacggcgttgacgatgcgctgcgctct
atcgctggagatagcgtctccgggctgggaaccggcggcatgggcactaagcttcaggcg
gctgacgtcgcctgccgcgcgggtattgatacgattattgcctcaggcagtaagccgggc
gttatcggtgatgtgatggaggggatctccgttggcacccgttttcatgcgcaagcttcg
ccgctggagaaccgcaaacgctggatcttcggtgcgccgccggcaggtgaagttacggtt
gatgaaggtgcgactgcagcaatgctggaacgcggcagctcacttttgccaaaagggatc
aaaagcgtgacaggcaacttctcgcgtggtgaagtgattcgcatctgtaatcaggaaggg
cgagatatcgctcacggcgtcagccgctataacagcgacgctctgcggcggattgccggg
caccattctcaacaaatcgatgcgattctgggctatgaatatggtccggtcgctgtccat
cgcgatgacatgattacccgataa

DBGET integrated database retrieval system