KEGG   Salmonella bongori N268-08: A464_3037Help
Entry
A464_3037         CDS       T02733                                 

Definition
(GenBank) Acetyl-CoA acetyl transferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sbz  Salmonella bongori N268-08
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:sbz00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    A464_3037
   00630 Glyoxylate and dicarboxylate metabolism
    A464_3037
   00640 Propanoate metabolism
    A464_3037
   00650 Butanoate metabolism
    A464_3037
  Lipid metabolism
   00071 Fatty acid degradation
    A464_3037
   00072 Synthesis and degradation of ketone bodies
    A464_3037
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    A464_3037
   00310 Lysine degradation
    A464_3037
   00380 Tryptophan metabolism
    A464_3037
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    A464_3037
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    A464_3037
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    A464_3037
Enzymes [BR:sbz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     A464_3037
Exosome [BR:sbz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A464_3037
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3030284..3031492)
Genome map
AA seq 402 aa AA seqDB search
MAVSFCAEVVMKEVVIVAALRTPIGCFQGTLARHSAVELGSMVVKALIERSGVDVNAIDE
VILGQVLTAGAGQNPARQSAIKGGLPNTVSAITINDVCGSGLKALHLATQAIQCGEADIV
IAGGQENMSRAPHVLNDSRTGALPDADNLVDSLVHDGLWDAFNDYHIGVTAENLAREYGI
SRELQDAWALSSQQKARAAIDTGRFKDEIVPVITQRNGQIAIVDTDEQPRADTSAEGLAQ
LHPAFDSFGSVTAGNASSINDGAAAVMMMSEAKAMELGLPILARIRAFASVGVDPALMGI
APVYATRRCLERAGWQLADVDLIEANEAFAAQAISVGKMLEWDERRVNVNGGAIALGHPI
GASGCRILVSLVHEMVKRDARKGLATLCIGGGQGVALTVERD
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggcggtgtcattttgcgctgaggtggtaatgaaagaggttgtgattgtggcggcactg
cggacgcccatcggctgttttcagggaacgctggcccgtcattccgccgtcgagctgggg
agcatggtcgtaaaagcgttgattgagcgcagtggcgtggatgttaatgctatcgatgag
gtcatccttggtcaggtgctgaccgccggcgccgggcagaacccggcacgccagtccgct
atcaagggggggctgcctaataccgtttccgctattaccattaatgacgtttgtggttcc
ggtttaaaagcattgcaccttgcgacgcaggctattcagtgcggtgaggcagacattgtt
atcgcgggtgggcaggaaaatatgagccgtgcgccgcatgtcctcaatgacagccgtact
ggcgcgctacctgatgctgacaatctggtggatagcctggtacatgacggcttatgggac
gcttttaacgattatcacattggcgtaacggcagaaaatctggcgcgggaatatggtatc
agccgtgaattacaggatgcctgggcgctcagttcgcagcaaaaggccagggcggcgatc
gataccggacgttttaaagatgagattgtccctgtcatcacgcagcgtaacgggcagatc
gcgattgtcgataccgatgaacaaccgcgcgctgacaccagtgcggaagggttagctcaa
ttgcatccggcatttgatagttttggttcggtaacggcgggtaatgcctcatcaattaat
gacggcgccgccgccgtgatgatgatgagcgaggcgaaagccatggaattggggttaccg
atactggcgcgcatccgcgcgtttgccagtgtcggcgtcgatccggcgctgatgggtatt
gctccggtatatgccacccggcgttgcctggagcgggcaggatggcaactggcggatgtt
gatcttattgaagccaacgaagcgtttgccgcccaggcgatatcggtcggaaaaatgctg
gaatgggatgagcgacgggtgaatgttaacggcggtgcaatagccttggggcatcccatt
ggtgcttccggttgccgaattcttgtttcactggtgcatgaaatggttaaacgcgatgcg
cgaaaagggctggcaacgctttgtatcggcggtggtcagggcgtcgctttaacggttgag
cgtgactga

DBGET integrated database retrieval system