KEGG   Salmonella bongori N268-08: A464_3593Help
Entry
A464_3593         CDS       T02733                                 

Definition
4-alpha-glucano transferase (amylomaltase)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
sbz  Salmonella bongori N268-08
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbz00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    A464_3593
Enzymes [BR:sbz01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     A464_3593
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3552621..3554699)
Genome map
AA seq 692 aa AA seqDB search
MENKRLDSAALAAGISPSYINAHGKPQSIGAETKRRLLAAMRGTAAGPQAIIPNVKVYTV
GKKMSLPIEGRGEFAWLLTTEEGEQYKGRVVGGKKLNLPATLPEGYHTLTLTQGEQRVHC
RIIVAPQRCYEPQALREGKKLWGACVQLYTLRSEKNWGIGDFGDLKSMLVDVAKRGGAFI
GLNPIHALYPANPESASPYSPSSRRWLNVIYIDVNAIEDFRLSEEAQAWWQMPATQQTLR
QARDAQWVDYAAVTALKITALRMAWTRFAARDDAQMAAFRHFIAREGESLYWQAAFDALH
AHQVKEDEQRWGWPAWPEAYQSIESPAVKQFCEAHREEVEFYLWLQWLAWSQFAACWDIC
QRFKLPIGLYRDLAVGVAEGGAETWCDRELYCLKASVGAPPDILGPLGQNWGLPPMDPHI
IAARAYEPFIDLLRANMQNCGALRIDHVMSLLRLWWIPYGETADKGAYVQYPVDELLAIL
ALESQRHRCMVIGEDLGTVPVEIVGKLRDSGVYSYKVLWFENDLEKNFRAPKAYPHQAMA
VASTHDLPTLRGYWECGDLTLGKALGLYPDEVVLRGLYEDRERAKQGLLDALHHYGCLPK
RAGRKASLMSMTPTLNRGLQRYIADSNSGLLGLQPEDWLDMADPVNVPGTSNQYKNWRRK
LSASLEAMFADERVNKLIKDLDRRRKAAAKKK
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
atggaaaataaacgtctcgatagtgccgcgctggcggcggggatcagccccagttacatc
aatgctcatggcaaaccgcagtctattggcgctgaaaccaagagacgtttgctggcagcg
atgaggggtacagccgccgggccacaggcgatcataccgaatgtgaaagtctataccgtt
ggtaaaaaaatgtccttgccaatagagggacgcggcgagtttgcctggctgctgacgact
gaagaaggcgagcaatataaagggcgcgtggttggcggtaaaaaactcaaccttccggca
acgctgccggaaggttatcacaccctgacattgacccagggtgaacagcgtgtgcactgt
cgtattatcgtcgcgccgcaacgatgctatgagccgcaggcgttgcgggaagggaaaaaa
ctgtggggcgcatgcgtccagctttataccctacgctcagaaaaaaactggggcattggc
gattttggcgatttgaagtcaatgctggtcgatgtggcgaagcgcggcggcgcgtttatt
ggtctgaatccgatccatgcgctttatccggcgaatccggaaagcgccagcccctatagt
ccttcctcccggcgctggttgaatgtcatttatattgatgtcaacgctatagaagacttc
cgcctgagcgaagaggcgcaggcgtggtggcaaatgcccgccacgcagcaaacgctgcga
caggcgcgcgatgcgcaatgggtcgattacgctgccgttaccgcgctgaaaatcacggcg
ctgcggatggcgtggacgcggtttgccgctcgcgacgatgcgcaaatggcggcgtttcgt
cactttatcgcccgcgaaggtgagagcctttactggcaggcggcattcgacgcgctgcac
gcgcaccaggtgaaagaggacgagcagcgctggggctggccagcctggccggaggcgtac
cagtcgatagagtctcccgctgtaaaacaattctgtgaagcgcaccgcgaagaggtggag
ttttacctctggctacaatggctggcctggagccaatttgccgcctgctgggatatctgt
caacgttttaaactgccgattggtctgtatcgcgatctggcggttggcgtggcggaaggc
ggcgcggaaacctggtgcgaccgtgaattatactgtctgaaagcgtcggtcggcgcgcca
ccggatatccttggcccactagggcaaaactggggattgccgccgatggacccgcatatt
atcgccgcacgggcgtatgagccctttatcgacctgctgcgcgccaatatgcaaaactgc
ggcgcgctgcgcattgaccatgttatgtcactgttgcgtttatggtggataccgtatggc
gaaacggcagataaaggggcgtatgttcagtatccggttgacgagctgctggctattctg
gcactggagagccagcgtcatcgctgtatggtgataggtgaggatctgggaaccgtaccg
gttgagattgttggcaagctgcgcgatagcggggtctattcttacaaagtactgtggttt
gaaaacgatcttgagaaaaacttccgtgcgccaaaagcgtatcctcaccaggcaatggcc
gttgcctcaacgcacgatctccctactttgcgcggttattgggaatgtggtgatctgacg
ttgggcaaagccctgggactttatccggatgaagtcgtactgcgtgggttatacgaggat
cgcgagcgggcgaagcagggactactggatgccttacatcactatggctgtctgccgaaa
cgcgccggacgtaaagcatccttaatgtcaatgacgccgacgctaaatcgcggtcttcag
cgctatatcgccgacagtaacagcgggttgctggggcttcagccggaggattggctggac
atggccgatccggttaatgtaccgggcaccagcaatcagtataaaaactggcggcggaaa
ttatccgcttctcttgaagcgatgtttgccgacgaacgggtaaacaagctgattaaggat
ctggacagacgccggaaagcggcagcgaagaaaaagtaa

DBGET integrated database retrieval system