KEGG   Salmonella bongori N268-08: A464_3606Help
Entry
A464_3606         CDS       T02733                                 

Definition
14-alpha-glucan (glycogen) branching enzyme, GH-13-type
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
sbz  Salmonella bongori N268-08
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:sbz00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    A464_3606
Enzymes [BR:sbz01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     A464_3606
Exosome [BR:sbz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A464_3606
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3574123..3576309)
Genome map
AA seq 728 aa AA seqDB search
MSSRIDRDVINALIAGHFADPFSVLGMHQTQAGLEVRALLPDATDVWVIETKTGRKVGKL
ECLDARGFFCGVLPRRKNFFRYQLAVVWHGQQNLIDDPYRFGPLIQEMDAWLLSEGTHLR
PYETLGAHADTMDGVTGTRFSVWAPNARRVSVVGQFNYWDGRRHPMRLRKESGIWELFIP
GAHNGQLYKFELLDANGNLRIKADPYAFEAQMRPETASMICGLPEKVTQSEERQKANRFD
APISIYEVHLGSWRRHTDNNFWLSYRELADQLVPYAKWMGFTHLELLPVNEHPFDGSWGY
QPTGLYAPTRRFGTRDDFRYFINAAHAAGLNVILDWVPGHFPSDEFSLAEFDGTHLYEHS
DPREGYHQDWNTLIYNYGRREVSNYLVGNALYWIERFGIDALRVDAVASMIYRDYSRKEG
EWIPNEFGGRENLEAIEFLRNTNRIIGEQVPGAVSMAEESTDFAGVTRPPEMGGLGFWYK
WNLGWMHDTLDYMKLDPVYRQYHHDKLTFGMVYNHTENFVLPLSHDEVVHGKKSILDRMP
GDAWQKFANLRAYYGWMWAFPGKKLLFMGNEFAQGREWNHDVSLDWHLLEGGDNWHHGVQ
RLVRDLNHTYRHHKALHELDFDAYGFEWLVVDDHERSVFIFVRRDKAGNEIIIASNFTPV
PRHDYRFGINQPGRWREILNTDSMHYHGSNAGNGGVVHSDEIESHGRPHSLSLTLPPLAT
IWLMREGE
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgtccagtcgtatcgatagagacgtgattaatgcgctaattgcaggacattttgcggac
cctttttccgtactcggaatgcaccagacccaagccggactggaagtccgcgccctatta
cctgacgccaccgacgtatgggtgattgagaccaaaaccggacgtaaagtcggcaaactg
gaatgtctcgatgctcgcggttttttctgcggcgttttacccagacgtaaaaatttcttt
cgctatcagctcgccgtggtctggcacggacagcaaaatctgatcgacgatccttaccgt
tttggtccattgattcaggaaatggatgcctggctgttatcggaaggtactcacctgcgt
ccttatgaaacgctgggtgcgcacgctgatacgatggacggtgtcaccggtacccgtttt
tctgtctgggcgcctaatgcccgccgcgtttcggttgtaggacaatttaactactgggat
ggccgtcgccacccgatgcgtctgcgcaaagagagcggtatttgggagctgtttatccct
ggcgcgcataatgggcaactgtataaattcgaactgctcgacgcgaatggaaatctgcgc
attaaagctgacccgtatgcctttgaggcgcagatgcgtccggaaacggcgtcgatgatc
tgcggcttgccggagaaggtgacgcaaagcgaagaacgacaaaaagccaatcggtttgac
gcgccgatctcgatttacgaggtgcatttaggttcatggcgacgccatacggataacaac
ttctggctgagctaccgtgaactggccgatcagcttgtgccttacgccaaatggatgggc
tttacgcaccttgaactcttgccggttaacgaacatccgtttgacggcagctggggctac
cagccaaccgggctttatgcccccacccgtcggttcggcacgcgtgatgatttccgctat
ttcatcaatgcagctcacgcggcaggactgaatgtcattctcgactgggtaccgggccat
tttccgtccgatgagtttagcctggcggagtttgacggtacgcacctctatgagcacagc
gatccgcgcgaggggtatcaccaggactggaacacgttgatttataattatggccgtcgt
gaggtcagtaactacctggtgggtaatgctctgtactggatagagcgtttcgggattgat
gcgctgcgtgtggatgcggtggcctctatgatttaccgcgactacagccgtaaagaaggc
gagtggatcccgaacgagttcggcggtcgtgaaaacctggaagccattgagtttctgcgt
aataccaaccgcattattggcgaacaggtgcctggcgcggtcagcatggccgaagagtcg
acagactttgccggcgtgacgcgtccgccagaaatggggggactggggttctggtacaag
tggaatctgggctggatgcatgacactctggactacatgaagctggacccggtctaccgc
cagtaccatcacgataagctcaccttcggcatggtgtataaccataccgaaaattttgtc
ctgccgctgtcgcacgatgaagtcgttcacggtaaaaaatctatcctcgatcgtatgccg
ggcgatgcgtggcagaaattcgccaacctgcgcgcctactatggctggatgtgggccttc
cccggtaagaaactgttgtttatgggcaatgaatttgcccagggacgcgagtggaaccat
gacgtcagtctcgactggcatctgttggaagggggagataactggcaccacggtgttcag
cgtctggtgcgcgatctcaaccacacctatcgccaccataaggcgctgcatgagctggat
tttgatgcttacggctttgagtggctggtggtcgatgaccatgagcgctcggtgtttatt
ttcgtgcgtcgcgataaagccggtaacgagattattattgccagcaactttacgcctgtt
ccccgtcacgactatcgctttggcatcaaccagccaggacgctggcgtgaaatcctcaat
actgactcaatgcattatcacggtagcaacgccggcaatggtggcgtggtacatagcgat
gagatcgaaagtcatggccgtccgcactctcttagcctgaccttgccgccgctggcgacg
atctggctgatgcgggagggggaatga

DBGET integrated database retrieval system