KEGG   Salmonella bongori N268-08: A464_3741Help
Entry
A464_3741         CDS       T02733                                 

Definition
Xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
sbz  Salmonella bongori N268-08
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbz00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    A464_3741
   00051 Fructose and mannose metabolism
    A464_3741
Enzymes [BR:sbz01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     A464_3741
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3726223..3727545)
Genome map
AA seq 440 aa AA seqDB search
MQAYFDQLDRVRYEGPQSTHPLAFRHYNPDELVLGKRMEDHLRFAACYWHTFCWNGADMF
GVGAFNRPWQQPGEALELAKRKADVAFEFFHKLNVPFYCFHDVDVSPEGASLKEYKNNFA
QMVDVLAAKQEQSGVKLLWGTANCFTNPRYGAGAATNPDPEVFSWAATQVVTAMNATHKL
GGENYVLWGGREGYETLLNTDLRQEREQIGRFMQLVVEHKHKIGFQGTLLIEPKPQEPTK
HQYDYDAATVYGFLKQFGLEKEIKLNIEANHATLAGHSFHHEIATAIALGLFGSVDANRG
DAQLGWDTDQFPNSVEENALVMYEILKAGGFTTGGLNFDAKVRRQSTDKYDLFYGHIGAM
DTMALALKVAARMIEDGQLDQRVAKRYAGWNGELGQQILKGQMSLTDIAQYAEQHNLAPV
HKSGHQEQLENLVNHYLFDK
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcttattttgaccaactcgatcgcgttcgctacgaaggccctcaatcgactcac
ccgctggcattccgtcattacaatcccgatgagctggttttaggcaaacgtatggaagat
cacctgcgttttgcggcctgttactggcataccttctgctggaacggtgcggacatgttt
ggcgtgggagcgtttaaccgcccctggcagcagccgggtgaagcgctggaactggcgaag
cgcaaagcggacgtggcgtttgaatttttccacaaattgaacgtgcctttctactgcttc
catgatgtggatgtgtcgccggaaggcgcgtcattgaaagagtataaaaacaacttcgca
cagatggtggatgtactggcggcgaaacaagaacaaagcggcgtgaaactgctgtggggc
acggcgaactgttttactaatccgcgttacggcgcaggcgccgccactaacccggacccg
gaagtctttagctgggcggcgacgcaggtggttaccgccatgaacgcgacccacaagctg
ggcggcgaaaactacgtgctgtggggcggacgcgaaggttatgaaacgttgctgaatacc
gatctgcgtcaggagcgcgagcagattggccgctttatgcagctggttgttgagcataag
cacaaaatcggcttccagggcacactgctgattgaaccgaaaccgcaggaaccgaccaag
caccagtatgattacgatgcggcaaccgtgtacggcttcctgaaacagtttggtctggaa
aaagagatcaaactgaacattgaagcgaaccacgcgacgctggcaggtcattctttccac
catgaaattgcgacggccatcgcgctgggtctgtttggttccgtggatgccaaccgtggc
gacgcgcaattgggctgggatactgaccagttcccgaacagcgtcgaagaaaatgcgctg
gtgatgtatgaaatcctcaaagcgggcggcttcaccaccgggggtctgaactttgatgcc
aaggttcgccgtcagagtaccgataaatacgatctgttctacggccatattggcgcgatg
gataccatggcgctggcgctgaaggttgcggcgcgtatgattgaagatggtcaactcgat
cagcgcgtggctaaacgctacgctggctggaacggcgagctgggccagcagatcctgaaa
gggcagatgtccctgaccgacattgcgcagtatgcagagcagcataacctggcgccggta
cacaaaagcggccatcaggaacaactggaaaatctggtcaaccattacctgttcgataag
taa

DBGET integrated database retrieval system