KEGG   Salmonella bongori N268-08: A464_3745Help
Entry
A464_3745         CDS       T02733                                 

Definition
Periplasmic alpha-amylase
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
sbz  Salmonella bongori N268-08
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbz00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    A464_3745
Enzymes [BR:sbz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     A464_3745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3730291..3732318
Genome map
AA seq 675 aa AA seqDB search
MKLAAFALTLIPGITIASSWTSPSFPAFSAQEAGRFTSQATLTKGTRALTLHINQQCWQP
ADAIKLNQMLSLKPCEGTPPQWRLFKDGDYTLTVDTRSGTPTLLLSIKTAPERTTQLARQ
CPAWDGLPLTLDVSQTFAEGTVVRDYYSGQTDTVQNGQITLQPADSHGLLLLERAETHVS
APFNWHNATVYFVLTDRFRNGDPTNDHSYGRHKDGMQEIGTFHGGDLRGLTGKLDYLQQL
GVNALWISAPFEQIHGWVGGGTKGDFPHYAYHGYYTQDWTTLDANMGSEADLRALVDGAH
QRGIRILFDVVMNHTGYATLADMQEYQFGALYLSDTERQKILGNRWTNWRPAAGQSWHSF
NDYINFSDNAAWEKWWGKKWIRTDIGDYDNSGFDDLTMSLAFLPDLKTESTVPSGLPVFY
QNKPDTRAKAIANYTPRDYLTHWLSQWVRDYGIDGFRVDTAKHVELPAWQQLKTQASAAL
ADWKKANPVKALDDAPFWMTGEAWGHGVMKSDYYRYGFDAMINFDYQEQAAKAVDCLAEM
GPVWQQMADKLQDFNVLSYLSSHDTRLFREGGDNTAELLLLSPGAVQIFYGDESARPLGP
TGSDPLQGTRSDMNWQDVSGKSAMTVAHWQRISQFRARHPAVGAGQQTTLTLKQGYGFVR
QYGDDTVIIVWAGRR
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atgaaactagctgccttcgctctgacgctgatacccggtatcacaatcgcctcatcatgg
acctcgccaagctttcctgcgttctcggcgcaggaagcaggccgctttaccagtcaggcc
acgttaaccaaaggtacacgtgctttaacgctgcatattaaccaacagtgctggcagccc
gccgacgccatcaaactcaaccagatgttgtcgttaaagccttgtgaaggcacgccgccg
caatggcgtctgtttaaagacggcgactatacgctaacggtagatacccgctccggcacg
ccaaccctgttactatcgataaaaacggcaccagaacgcacaacgcagcttgcccgccag
tgccccgcctgggacggtttgccgctcacgctggacgttagccaaacttttgcggaaggg
accgtagtacgtgattattacagcggtcaaaccgataccgtacaaaacgggcaaatcacg
ctgcagccagccgacagccatgggctcttattgcttgaacgtgcggaaacccacgtgtca
gcgccttttaactggcataacgccaccgtctactttgtgcttacggatcgctttcgcaac
ggtgatccgaccaacgatcacagctatggccgccacaaagatggtatgcaggagattggc
actttccacggaggtgatttacgcggactcacaggtaaactggactatttacagcaatta
ggcgtgaatgccttatggataagcgcgccatttgaacagatccacggctgggtcggcggc
gggacaaaaggcgattttccgcattacgcctatcacggttattacactcaggactggacg
acgctggatgctaatatgggtagcgaagccgatctccgcgctctggtcgacggcgcgcac
cagcgcggcattcgcattctgtttgatgtagtaatgaatcacaccggttatgccacgctg
gcagatatgcaagagtaccaatttggcgcgctctatctctcggatacggaacggcaaaaa
atcctcggcaatcgctggacgaactggcgccctgctgccgggcaaagctggcacagtttt
aatgattacatcaatttcagcgataatgctgcctgggaaaaatggtggggtaaaaagtgg
atccgtaccgatattggcgattacgacaattcgggatttgacgatctgaccatgtcactg
gcgtttttgcccgatctgaaaacagaatctaccgtgccctctggcctgccagtgttttat
caaaacaagccagatactcgcgccaaagccatcgcaaattatacgccacgcgattatctg
acccactggctcagccagtgggtgcgtgactacggcatcgacggctttcgggtcgatacg
gcgaaacacgttgagttacccgcctggcaacagcttaaaacccaggccagcgccgcgctg
gccgactggaaaaaagccaacccggtgaaagcactcgacgatgcccccttctggatgacc
ggcgaagcatggggccacggcgtcatgaaaagcgattattatcgctatggtttcgacgcc
atgatcaattttgattatcaggagcaggcggcgaaagccgtcgattgcctggcggagatg
ggaccggtctggcagcaaatggcggataagctccaggatttcaacgtactaagttacctt
tcttcacatgatacgcggcttttccgcgagggcggtgataacacggcggaactgctactg
ctgtcgccgggcgcggtacagattttttacggtgatgaatccgctcgccccctcggtcct
accggctccgacccgctgcaaggcacccgttcagatatgaactggcaggacgtgagcgga
aaatcggccatgactgtcgctcactggcagcgtattagccagttccgcgccagacatccc
gccgtcggcgcaggtcagcaaactacgctcacgctaaaacaggggtacggctttgtacgc
cagtatggcgatgataccgtgataatcgtctgggcgggccgccggtaa

DBGET integrated database retrieval system