KEGG   Salmonella bongori N268-08: A464_3952Help
Entry
A464_3952         CDS       T02733                                 

Definition
Ribo kinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
sbz  Salmonella bongori N268-08
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:sbz00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    A464_3952
Enzymes [BR:sbz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     A464_3952
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3938910..3939839
Genome map
AA seq 309 aa AA seqDB search
MKTAGNLIVLGSINADHILNLESFPTPGETVTGSHYQVAFGGKGANQAVAAGRSGANIAF
IACTGDDDIGDSIRKQLVSDRVDIAPISVIKGESTGVALIFVNGEGENVIGIHAGANAAL
SPALVDAQHERIAQADALLMQLESPLESVLAAAKIAHQHHTMVALNPAPARELSDELLAL
VDIITPNETEAEKLTGVRVENDEDAAKAAQVLHDKGIQTVLITLGSRGVWASVNGEGRRV
PGFRVEAVDTIAAGDTFNGAFITAMLEDTPLPEAIRFAHAAAAIAVTRKGAQPSVPWREE
IEAFLRQQG
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccgcaggcaatctcattgttcttggcagcattaatgccgatcatatccttaat
cttgaatccttccctacaccgggtgaaacggtaaccggtagccattatcaggttgcattt
ggcgggaaaggtgcgaatcaggcggttgctgcgggacgtagcggggcaaatattgcgttt
atcgcctgcacaggcgatgacgatattggcgacagtattcgtaaacaattagtcagtgat
cgtgttgatatcgcgccgattagcgtcattaaaggcgagtctaccggagtggcactgatt
tttgttaacggcgaaggtgagaacgtcatcggtattcatgccggggcaaatgccgcttta
tcgcccgcactggttgatgcgcaacatgagcgaatcgcgcaggcggatgcgttattgatg
caactggaatcgccgttggaaagcgtactggctgcggcgaaaattgcccatcaacatcat
actatggtggcgcttaacccggcgcctgcccgtgagctgtcggacgaactgttggcgctg
gtggatatcattacaccaaatgaaacagaagcggaaaaactgacgggcgtgcgcgtggaa
aatgacgaagatgccgcgaaagctgcgcaggtcttgcatgataagggcattcaaaccgta
ttaattacgttaggaagccgcggcgtctgggctagcgtaaatggcgagggccgccgtgtc
cctggatttagagtcgaggctgtcgataccattgccgccggggatacgtttaacggcgca
tttattaccgcgatgctggaggacacgccgttgcctgaggcgattcgttttgcccacgcc
gccgcagcgattgccgtgacgcgtaaaggcgcgcaaccttccgttccgtggcgcgaagag
atagaagcatttttacgtcagcaggggtaa

DBGET integrated database retrieval system