KEGG   Salmonella bongori N268-08: A464_4615Help
Entry
A464_4615         CDS       T02733                                 

Definition
(GenBank) Thymidine phosphorylase
  KO
K00758  thymidine phosphorylase [EC:2.4.2.4]
Organism
sbz  Salmonella bongori N268-08
Pathway
sbz00240  Pyrimidine metabolism
sbz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbz00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    A464_4615
Enzymes [BR:sbz01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     A464_4615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 PYNP_C Glycos_trans_3N
Motif
Other DBs
NCBI-ProteinID: AGR61797
UniProt: S5NNJ4
Position
4654807..4656129
Genome map
AA seq 440 aa AA seqDB search
MFLAQEIIRKKRDGHALSDEEIRFFINGIRDNTISEGQIAALAMTIFFHDMTMPERVSLT
MAMRDSGTVLDWKSLNLNGPIVDKHSTGGVGDVTSLMLGPMVAACGGYVPMISGRGLGHT
GGTLDKLEAIPGFDIFPDDNRFREIIKDVGVAIIGQTSSLAPADKRFYATRDITATVDSI
PLITGSILAKKLAEGLDALVMDVKVGSGAFMPTYELSEALAEAIVGVANGAGVRTTALLT
DMNQVLASSAGNAVEVREAVQFLTGEYRNPRLFDVTMALCVEMLISGNLAKDDAEARAKL
QAVLDNGKAAEVFGRMVAAQKGPSDFVENYDKYLPTAMLSKAVYADTEGVVSAMDTRALG
MAVVSMGGGRRQASDTIDYSVGFTDMARLGDSIDGQRPLAVIHAKDEASWQEAAKAVKAA
IILDDKAPASTPSVYRRITE
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
gtgtttctcgcacaagaaattattcgtaaaaagcgtgatggtcatgcgttgagtgacgaa
gaaattcgtttctttatcaatggtattcgtgacaatactatctccgaaggacagattgcc
gccctggcgatgaccatcttcttccacgatatgaccatgccggagcgtgtttcgctgacc
atggcgatgcgggattcaggtaccgttctcgactggaaaagcctgaatctcaatggcccg
attgtcgataagcattcgaccggcggcgtgggggacgtgacgtctctgatgttggggcca
atggtagcggcctgcggcggctatgtgccgatgatctctggtcgtggcctcggtcacacc
ggtggtacgctcgataaactggaggcgatcccggggtttgatatcttcccggacgacaac
cgtttccgcgaaattattaaagacgtgggtgtggcgattattgggcaaaccagttcgctt
gcaccggcagataaacgtttttatgccacccgtgatattaccgcgacggtggactctatt
ccgctgatcaccggttccatcctcgccaaaaaactggctgaagggctggatgcgctggta
atggacgtaaaagtcggcagcggcgcgtttatgccgacctatgaactttctgaagccctt
gctgaagctattgtcggcgtggcaaacggcgcgggagttcgcactacggcgttgttaacc
gatatgaaccaggtgctggcttcgagcgccggtaacgcggtggaagtgcgtgaagccgtg
cagttcctgaccggtgaataccgcaatccgcgcctgtttgacgtcaccatggccctgtgt
gtggagatgctgatctccggcaatctggcgaaagatgacgccgaagcccgcgcgaaattg
caggcggtgctggataacggtaaagcggcagaagtctttggtcgtatggtggccgcgcag
aaagggccgagcgatttcgttgagaactacgataaatacctgccgaccgccatgttgagc
aaagcagtatatgctgatactgaaggggttgtcagtgcgatggatacccgtgcgttaggc
atggctgttgtgtcgatgggcggcggtcgtcgtcaggcgtcggacactattgattacagc
gtcggctttaccgatatggcgcgtctgggcgacagcattgatggacagcgtccgctggcg
gtgatccacgctaaagacgaagccagctggcaggaggcggcgaaagctgttaaagcggca
attatccttgacgataaagcaccagcaagcacaccttcggtctatcgtcgtattactgaa
tag

DBGET integrated database retrieval system