KEGG   Staphylococcus carnosus: Sca_0033Help
Entry
Sca_0033          CDS       T00863                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
sca  Staphylococcus carnosus
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sca00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Sca_0033 (dapE)
  Amino acid metabolism
   00300 Lysine biosynthesis
    Sca_0033 (dapE)
Enzymes [BR:sca01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Sca_0033 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(34001..35167)
Genome map
AA seq 388 aa AA seqDB search
MGKLSSEEKVEILADLVGIESVNDNELDVANYLHDLFQKHHIDSKIIKLTDTRANLVAEI
GSGSPVLAVSGHMDVVSPGDSSKWQTPPFKLTEDSEGHLHGRGASDMKSGLAAFVISMIE
LHEQGLPKHGTVRLLATAGEEIEGHGAKAFYKDGYMNDVDALVIAEPSKDKIIYAHKGSM
DIRVTSNGKSVHSSMPSLGYNAINPLVDFVNRINQAYNSITESNDLLGDSVVSATIINGG
SQVNSIPDYAEAEFNVRTIPEADNDSYQKLFEQIAKNVKVDAPDSYLNIDTYMSRPPVFT
KGDNRLVDIAQSLSKKYLGKEVPKKASPGVTDASDLVVDKGEDFPFIMFGPGETSQAHVI
DEYVDKKDYLNFIDLFEDLLVEYLDENE
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaattaagttctgaagaaaaagttgaaatattagcagacttagtaggtattgaa
tctgtaaatgataacgaattggatgtagcaaactacttacatgacttattccaaaaacat
catatagattctaaaatcataaaacttactgatacacgcgctaatttggtagctgaaata
ggaagtggcagtccagttctagccgtttcagggcatatggacgttgtatctcctggagat
tcttcaaaatggcagactccgcctttcaaattaactgaagatagcgaagggcatttacat
gggcgcggtgcttcagatatgaaatcaggtcttgctgcgtttgtaatcagtatgatcgaa
ctccatgaacaaggattgcctaaacacggtacagttcgtttattagcaacagctggtgaa
gaaattgaaggacacggcgcaaaagctttttataaagacggctatatgaatgatgtagat
gcgcttgttatcgcagaaccttctaaagataaaattatatatgcacacaaaggttccatg
gatattcgtgtcacttcaaatggtaaatctgttcatagctctatgccgagtctaggctat
aatgcaattaatcctctcgttgattttgttaatcgtattaatcaagcttataattcaatc
acagaaagcaacgatttattaggagattcagttgtcagcgcaacaatcatcaatggcggt
tctcaagtcaattcaattccggattatgcagaagctgaattcaatgtgagaacgattcct
gaagcagacaacgatagttatcaaaaactttttgaacaaattgctaaaaatgtaaaagtg
gatgcaccagacagctatttaaatatcgacacttatatgtctcgccctcctgtcttcact
aaaggtgataaccgcttagttgatattgcccaatcattaagtaaaaaatacttaggcaaa
gaagttccgaaaaaagcttcacctggagtaaccgatgcttctgacttagtagtagataaa
ggagaagatttcccgttcatcatgttcggacctggcgaaacaagccaagcacatgtcatt
gatgaatatgtagataaaaaagattatttaaactttatagatttatttgaagacttatta
gtagaatacctagatgaaaatgaataa

DBGET integrated database retrieval system