KEGG   Staphylococcus carnosus: Sca_0083Help
Entry
Sca_0083          CDS       T00863                                 

Definition
putative esterase/lipase (EC:3.1.1.1)
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
sca  Staphylococcus carnosus
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
81388..82122
Genome map
AA seq 244 aa AA seqDB search
MLKVKAPKNLYLKGGERAVLLLHSFTGTIQDIKEVAEALNEEGFTCYAPCYTGHGLPVSE
FVKYDIQDWWKDVEAAYHFLQAEGYQEIDVIGVSLGGIFSLKLAEQFEVGRVVGMSIPYE
KREKGVIERLNTYGERLQHYILCTDDEQTEEMARIRDYETGAQRFEAFTDATMKELKNIT
APTLLMYGGQDDPSYRESAFKVAEALTKVDDKEVVCFENAGHLMPRSEDKSAIIERIVDF
LCKA
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaagttaaagcgccaaaaaacctttatttgaaaggtggggagcgtgcagtttta
ttacttcattcatttacgggcaccatccaagatattaaagaggttgctgaagctctgaat
gaagaaggatttacttgttatgcgccttgttacactggacatgggctgcccgtttctgaa
tttgtgaaatatgatattcaagattggtggaaagatgttgaagcagcatatcacttttta
caagcggaaggttatcaagaaattgatgtaatcggtgtttctttaggcggcattttttct
cttaaactcgcagaacaatttgaggttggtcgtgtggtaggaatgtctattccatatgaa
aaaagagaaaaaggtgtcatagaacgtttgaatacgtatggagaacggttgcagcattat
attttatgtacagatgacgaacaaactgaagaaatggctcgcattcgtgattatgaaacc
ggagcacaacggtttgaagcttttactgatgcaacaatgaaagaattaaaaaatataacg
gcaccaactttattgatgtatgggggacaagatgacccttcttatcgtgaaagtgcattt
aaagtagcagaagcattaacaaaggttgatgacaaagaagtggtatgttttgaaaatgct
gggcatctaatgccgcgcagtgaagacaaatcggcaattatagagagaattgtagatttt
ctatgtaaagcatga

DBGET integrated database retrieval system