KEGG   Staphylococcus carnosus: Sca_0121Help
Entry
Sca_0121          CDS       T00863                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
sca  Staphylococcus carnosus
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:sca03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
120696..121292
Genome map
AA seq 198 aa AA seqDB search
MHYPEPISKLIDSFMKLPGIGPKTAQRLAFHVLDMKEDDVVQFAKALVDVKRELTYCSVC
GHITEEDPCYICNDKQRDRSVICVVEDDKDVIAMEKMREYKGLYHVLHGAISPMDGIGPE
DINIPSLIERLKDEEVKELILAMNPNLEGESTAMYISRLVKPIGIKVTRLAQGLSVGGDL
EYADEVTLSRAIEGRTEM
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgcattatccagaaccgatttcgaaactaattgatagtttcatgaaattgccaggcatt
gggccgaaaacggcgcaacgtctggcttttcatgtattagatatgaaggaagacgacgtt
gtccaatttgcaaaggcattagtagatgtaaaacgtgaactcacatattgcagtgtctgt
ggacatataactgaagaagacccttgttacatttgtaatgacaaacaacgtgatcgctca
gtgatttgcgtagtagaagatgataaagatgtaattgctatggaaaaaatgagagagtat
aaaggtttgtatcatgtattacatggtgctatttctccaatggatggtattggtcctgag
gatatcaatattccttctttaattgaacgtttaaaagatgaagaggttaaagaattaatt
ctagcaatgaatcctaacttagaaggtgaatctactgcgatgtacatttccagattggtt
aaacctataggaattaaagtaacgcgtttagcacaaggtttatcagtcggcggagatttg
gaatatgcggatgaagtaacgttatctcgtgctatagaaggcagaacagaaatgtag

DBGET integrated database retrieval system