KEGG   Staphylococcus carnosus: Sca_0145Help
Entry
Sca_0145          CDS       T00863                                 

Definition
GHMP kinase family protein (EC:2.7.1.-)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
sca  Staphylococcus carnosus
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sca00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Sca_0145
Enzymes [BR:sca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Sca_0145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
147402..148172
Genome map
AA seq 256 aa AA seqDB search
MVMTTVDLNDRVTVEKRQDQRIVVQVDYNFVPENAKNLASQAALLMQETYDLKEGVTITL
EKEIPVSAGLGGGSADAAATMRAMNKLFDLQLSLDELSALGADVGSDVPFCIYSKTAICT
GHGEKVHLLNEMPKAWVVIAKPNVGISTACVFQELEIGEECNQQENTQKCIEAIENGDYE
TICATLSNCLESISMEMHPNIRKLKQNMLNSGADAALMSGSGPTVYSLAKHYKQAQNIYN
AVHGCCNEVYLVRLLG
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atggtcatgacgacggtggacttaaatgatcgtgttaccgtcgaaaaacgacaggaccag
cgtattgtggttcaagttgattataactttgtacctgaaaatgctaaaaatttagcatcg
caagcggcgctattaatgcaggaaacgtatgacctcaaagaaggtgtcacgattacattg
gaaaaggaaattccggtgtctgccggtttaggcgggggttcagcggatgctgcggcgacg
atgcgtgcgatgaataaactctttgatctgcaacttagtttggatgaattaagtgcactt
ggtgctgatgtgggttcagatgtaccgttttgtatttacagcaagacagcaatttgtaca
ggacatggcgaaaaggtacatcttttaaatgaaatgccgaaagcttgggttgtgattgca
aagccgaatgtcggtatttctacggcttgtgtttttcaagaactggaaatcggagaagaa
tgtaatcaacaagaaaatacgcaaaagtgtattgaagcgattgaaaatggagactatgaa
acgatttgtgcgaccctttcgaattgtttagaatcaatttcgatggagatgcatccgaat
atccggaagttaaagcagaatatgcttaatagcggtgcagatgctgcattaatgagcggc
agcggtcctacagtctacagcttagcgaaacactataagcaagcgcaaaatatttataat
gcagtgcatgggtgctgcaatgaggtctatttagtcagattactaggataa

DBGET integrated database retrieval system