KEGG   Staphylococcus carnosus: SCA_0165Help
Entry
SCA_0165          CDS       T00863                                 

Gene name
folP
Definition
(GenBank) dihydropteroate synthase chain A synthetase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
sca  Staphylococcus carnosus
Pathway
sca00790  Folate biosynthesis
sca01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sca00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SCA_0165 (folP)
Enzymes [BR:sca01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     SCA_0165 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind DUF4543
Motif
Other DBs
NCBI-ProteinID: CAL27078
UniProt: B9DLC3
Position
168847..169632
Genome map
AA seq 261 aa AA seqDB search
MAHTKIMGILNVTPDSFSDGGKYNSVETAVARGKEMMDEGVDIIDIGGVSTRPGHQEVAL
EDELERVIPVVRALSEFNVQLSIDTFRSEVAEQALEAGATMINDQWAGLYDPKMFETVAR
YDAEIVLMHNGDGERDEPIMDEMLLYLLKQANRAEEAGIKHDNIWIDPGIGFAKSRAEER
IVMDRLDELVATEYPVLLATSRKRFIKEMIGTDSRPEDRDEATAATTAYGIMKGVKAVRV
HNVELNARIAHGIDYLKENER
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggcacatacaaagattatgggtatattaaacgtaacgcctgattcgttttcagatggc
ggaaaatataattcagtggaaacagctgtagcacgtgggaaagaaatgatggatgaaggt
gttgatattatagatatcggcggcgtgtctacacgtccgggacatcaagaagttgcttta
gaagacgagcttgagcgtgtgattccagtagtacgtgcactgtctgaatttaatgtacag
ctttcaatcgatactttcagaagtgaagttgcagaacaggctttagaagctggtgcaact
atgattaatgatcaatgggcaggcttatatgaccctaaaatgtttgaaactgtagcacgc
tatgacgcagagattgtgctgatgcataatggcgatggcgaacgtgatgagccgattatg
gatgaaatgctgctctatttattaaaacaagctaatcgcgcagaagaagcaggtatcaaa
catgataatatttggattgatccggggattggcttcgctaaaagcagagcggaagaacgc
attgttatggaccgtttagatgaacttgtagcaacagagtatcctgttttattagcaaca
agccgcaaacgttttatcaaagaaatgattggaacggactctcgtccagaagacagagat
gaagcaacagcagctacgacagcttatggcattatgaaaggtgttaaagcagtcagagta
cataacgttgaattgaatgcgcgtattgcacacggcatagactacttgaaggagaatgaa
cgatga

DBGET integrated database retrieval system