KEGG   Staphylococcus carnosus: Sca_0220Help
Entry
Sca_0220          CDS       T00863                                 

Definition
putative deoxynucleoside kinase
Orthology
K15519  
deoxyadenosine/deoxycytidine kinase [EC:2.7.1.76 2.7.1.74]
Organism
sca  Staphylococcus carnosus
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sca00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Sca_0220
   00240 Pyrimidine metabolism
    Sca_0220
Enzymes [BR:sca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     Sca_0220
    2.7.1.76  2'-deoxyadenosine kinase
     Sca_0220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(229586..230248)
Genome map
AA seq 220 aa AA seqDB search
MNNYGIPQDAVITIAGTVGVGKSSLTRALAKKLNFRTSFENVDHNPYLDKFYDDFERWSF
HLQIYFLAERFKEQKRMFEYGGGFIQDRSIYEDVDIFAKMHEEQGTMSKEDFETYSQLFD
AMVMTPYFPKPDVLVYLECDYDEVIDRIHQRGRQMEIDTDPEYWKKLFRRYDEWIYNFNA
CPVVRVNINEYDLHESLDTLDPVLDKIANIIKIHREVDPR
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgaataattacggtatccctcaagatgcagtgattacaattgcaggtaccgtaggcgtt
ggaaaatctagtctgacacgcgcccttgcaaaaaaattaaacttccgcacttcttttgaa
aatgtggaccataacccttatttagataaattctatgatgacttcgaacgttggagtttt
catctgcaaatatatttcctagcggaacgctttaaagaacaaaaacgtatgtttgaatac
ggcggaggtttcatccaagatcgttcaatttatgaagacgttgatatctttgccaaaatg
catgaagaacaaggtacaatgtctaaagaagattttgaaacgtattcacaactttttgat
gcaatggttatgacaccttacttccctaaaccagatgttttagtttatctagaatgtgat
tatgatgaagttattgatcgtatccaccaacgcggtcgtcaaatggaaattgatacagac
cctgaatactggaaaaaattattccgtcgttacgacgaatggatttataacttcaatgct
tgccctgtagtacgtgttaatattaatgaatatgacttgcatgaaagtttagatacactt
gatccagtattagataaaatcgccaatattattaaaatacaccgtgaggtagacccaaga
taa

DBGET integrated database retrieval system