KEGG   Staphylococcus carnosus: Sca_0426Help
Entry
Sca_0426          CDS       T00863                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sca  Staphylococcus carnosus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sca00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sca_0426 (tpiA)
   01230 Biosynthesis of amino acids
    Sca_0426 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sca_0426 (tpiA)
   00051 Fructose and mannose metabolism
    Sca_0426 (tpiA)
   00562 Inositol phosphate metabolism
    Sca_0426 (tpiA)
Enzymes [BR:sca01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Sca_0426 (tpiA)
Exosome [BR:sca04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Sca_0426 (tpiA)
  Exosomal proteins of bladder cancer cells
   Sca_0426 (tpiA)
  Exosomal proteins of melanoma cells
   Sca_0426 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
440977..441738
Genome map
AA seq 253 aa AA seqDB search
MRKPIIAGNWKMNKTVQEAKDFVNELPQLPDTNEVEAVICAPTIQLDALITLVKEGKAEG
LEIGAENTYYEESGAFTGETSPVALADLGVKYVIIGHSERRELFHETDEDVNKKVHAVFK
HGMTPIICVGETNEQRESGKAEEVVSDQVKKALAGLSDEQLKQVVIAYEPIWAIGTGKSS
TAKDANEMSAFIRKTVAELSNQEVADAVRIQYGGSVKPNNIAEYMAESDIDGALVGGASL
KVEDYVKLLEGAK
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaccaattattgcaggtaactggaaaatgaataaaactgtacaagaggctaaa
gactttgtaaacgaattacctcaattaccagatacaaatgaagtagaagccgttatttgt
gcaccaactattcaattagatgcattaattactttagtaaaagaaggtaaagcagaagga
cttgaaattggtgctgaaaacacttattacgaagaaagcggcgcatttactggtgaaaca
tctccagttgcattagcagatttaggtgttaaatatgtaattatcggccattctgaacgt
cgtgaattgttccacgaaactgatgaagatgttaataaaaaagtccacgctgtgtttaaa
cacggtatgactccaatcatctgtgttggtgaaacaaatgaacaacgtgaaagcggaaaa
gctgaagaagttgtatcagatcaagttaaaaaagcattagcaggtttatctgacgaacaa
ttaaaacaagtagttatcgcttacgaacctatttgggcaattggtactggtaaatcttct
acagctaaagatgctaatgaaatgagcgcatttatccgcaaaacagttgctgaactttca
aaccaagaagtagcagatgcagttcgtattcaatacggcggcagtgtaaaacctaataat
atcgctgaatatatggcagaatcagatattgatggtgctttagtcggcggtgcttcattg
aaagtagaagactatgtaaaattattagaaggtgctaaataa

DBGET integrated database retrieval system