KEGG   Staphylococcus carnosus: Sca_0431Help
Entry
Sca_0431          CDS       T00863                                 

Gene name
est
Definition
carboxylesterase (EC:3.1.1.1)
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
sca  Staphylococcus carnosus
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
445733..446473
Genome map
AA seq 246 aa AA seqDB search
MQIKLPKPFFFEEGKRAVLLLHGFTGNSSDVRQLGRFLQKKGYTSYAPQYEGHAAPPEEI
LQSSPHVWFKDALDGYDFLVEHGYDEIVVAGLSLGGDFALKLSLNRDVEGIVTMCAPMFI
KTEGSMYEGVLEYARNFKKYQGKDEATINREMEAFHPTHTLKELQQTIQGVRDHVDEVMD
PLLVIQAEQDKMINPESANVIYDEASSEDKNIKWYADSGHVITIDKEKEKVFEDIYEFLE
SLDWPE
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgcagattaaattgccaaagccgttcttttttgaagaaggaaaaagagcagtattattg
ttacatggttttactggaaactcttccgatgtaagacaactcgggcgctttttacagaaa
aaaggttacacatcttatgcgcctcaatatgaaggccatgcagcgccaccggaagaaatt
ttgcaatccagcccgcatgtctggtttaaagatgcgttagatggttacgactttttagtg
gaacatggatatgatgaaattgtggtagccggcttatctttaggtggagattttgccctt
aagttaagcttaaatagagatgtagagggtattgtaacgatgtgtgcgcctatgtttatt
aagacagaaggctcaatgtatgaaggcgttcttgaatatgcgcgcaactttaaaaaatac
caagggaaagatgaggcgacaatcaatcgcgagatggaagctttccatccgactcatact
ttaaaagaattacagcaaacaatacaaggtgttcgagatcacgtagatgaagtgatggat
ccattacttgtcattcaagcagaacaagacaaaatgattaatcctgaatctgcaaatgtg
atttatgatgaagcatcttctgaagacaaaaatataaaatggtatgcggattccggtcat
gttattacaattgataaagaaaaagaaaaagttttcgaggatatttacgagttccttgaa
agtcttgattggcctgaatag

DBGET integrated database retrieval system