KEGG   Staphylococcus carnosus: SCA_0721Help
Entry
SCA_0721          CDS       T00863                                 

Gene name
pdhC
Definition
(GenBank) dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sca  Staphylococcus carnosus
Pathway
sca00010  Glycolysis / Gluconeogenesis
sca00020  Citrate cycle (TCA cycle)
sca00620  Pyruvate metabolism
sca01100  Metabolic pathways
sca01110  Biosynthesis of secondary metabolites
sca01120  Microbial metabolism in diverse environments
sca01130  Biosynthesis of antibiotics
sca01200  Carbon metabolism
Module
sca_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sca00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCA_0721 (pdhC)
   00020 Citrate cycle (TCA cycle)
    SCA_0721 (pdhC)
   00620 Pyruvate metabolism
    SCA_0721 (pdhC)
Enzymes [BR:sca01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SCA_0721 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H ATP-synt_ab_Xtn RnfC_N RP-C_C DUF2090 DUF896 Lin-8
Motif
Other DBs
NCBI-ProteinID: CAL27631
UniProt: B9DQ16
Position
723539..724879
Genome map
AA seq 446 aa AA seqDB search
MAFEFKLPDIGEGIHEGEIVKWFVKAGDEIEEDDILAEVQNDKSVVEIPSPVSGTIEEVV
VDEGTVAVVGDTIVKIDAPDAEEMSFKGGHSHDDSKEEAAEQQETKQQAATVSEEGTESA
SGDAPQTPTQDEEIDENRVVKAMPSVRKFARDNDVNIKAVKGSGKNGRITKADVEAYLSG
DTSSSVDESAASSESAPAETSSAQSAPVSAEGEFPETREKIPAMRKAIAKAMVNSKHTAP
HVTLMDEVEVQALWDHRKKFKEIAAEQGTKLTFLPYVVKALVSALKKYPALNSEFDEENG
EVVNKHYWNIGIAADTERGLLVPVVKHADRKSMFEISDEINELAVKARDGKLTSDEMKGA
SCTISNIGSAGGQWFTPVINYPEVAILGIGRIAQKPIVKDGEIVAAPVLALSLSFDHRQI
DGATGQNAMNHIKRLLNNPELLLMEG
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
gtggcatttgaatttaaattacccgatattggtgaaggtatccacgaaggtgaaattgta
aagtggtttgttaaagctggagacgaaattgaagaagatgatatcttagctgaggttcaa
aatgataaatcagttgtagaaatcccttctccagtttcaggtacaattgaagaagttgta
gttgacgaaggtacagtagcagttgtaggtgacacaatcgttaaaattgatgcacctgat
gcagaagaaatgtcattcaaaggcggacacagtcacgatgacagtaaagaagaagcagca
gaacaacaagagactaaacaacaagcagcaacagtttcagaagaaggaactgaatcagct
tctggtgatgcaccgcaaacaccaactcaagatgaagaaattgatgaaaatcgtgttgtt
aaagcaatgccttcagtacgtaaatttgcacgtgataacgatgttaatatcaaagctgtt
aaaggttctggtaaaaacggacgtatcactaaagcagacgttgaagcttacttaagcggc
gatacaagttctagcgttgatgaaagcgctgcatcaagcgaatcagctcctgcagaaact
tcatcagcacaatcagcacctgtatcagctgaaggtgaattcccagaaacacgcgaaaaa
atcccagcaatgcgtaaagcaattgcaaaagctatggtaaactctaaacatactgcgcct
catgtaacattaatggacgaagtagaagtacaagctttatgggatcaccgtaaaaaattc
aaagaaattgctgcggaacaaggtactaaattaacattcttaccttatgttgttaaagca
ttagtttcagcgcttaaaaaatacccagcattaaactctgaatttgatgaagaaaacggt
gaagtagttaacaaacactactggaacatcggtattgctgcagatacagaacgcggtcta
ttggtaccagttgttaaacacgctgatcgcaaatcaatgttcgaaatttcagatgaaatt
aatgaacttgctgttaaagctcgtgatggtaaattgacttctgacgaaatgaaaggtgct
tcatgcacaatcagtaacatcggttctgcaggcggtcaatggttcactcctgtaattaac
taccctgaggtagcaattttaggaatcggccgtattgctcaaaaacctattgttaaggat
ggggaaattgtagcagcacctgtattagcattatcattaagctttgaccatagacaaatt
gatggtgctactggtcaaaacgcaatgaatcacatcaaacgtttattaaataatccagaa
ttattattaatggaggggtaa

DBGET integrated database retrieval system