KEGG   Staphylococcus carnosus: Sca_0882Help
Entry
Sca_0882          CDS       T00863                                 

Gene name
sucC
Definition
succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
sca  Staphylococcus carnosus
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:sca01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:sca00020]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:sca00640]
Metabolism; Carbohydrate metabolism; C5-Branched dibasic acid metabolism [PATH:sca00660]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
883288..884454
Genome map
AA seq 388 aa AA seqDB search
MNIHEYQGKEIFRSMGVPVPEGRVAFTAEEAVEKAKELDTDVYVVKAQIHAGGRGKAGGV
KIAKSLSEVEAYANELLGKQLVTHQTGPEGKEVKRLYIEEGADIKKEYYVGFVIDRATDR
VTLMASEEGGTEIEEVAAKSPEKIFKETIDPVVGLAPFQARRIAFNINIPKESINKAAKF
LIALYNVFIEKDCSIVEINPLVLTGEGDVLALDAKINFDDNALFRHKDILELRDLEEEDP
KEIEASKYDLSYIALDGDIGCMVNGAGLAMATMDTINHFGGNPANFLDVGGGATKEKVTE
AFKIILGDDNVKGIFVNIFGGIMRCDIIAEGIVAAVKEVDLTLPLVVRLEGTNVELGKQI
LKDSGLAIEPAATMAEGAQKIVKLVKEV
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatatccacgagtatcaaggaaaagaaatctttcgttcaatgggcgttcccgttcca
gaaggacgtgtagcattcactgctgaagaagcagtagaaaaagctaaagaattagacact
gatgtttatgttgttaaagcacaaatccacgctgggggtagaggtaaagctggcggtgta
aaaatcgctaagtcattatctgaagtggaagcttatgctaatgaattgcttgggaaacag
cttgtaactcaccaaactggccctgaaggtaaagaagttaaacgtttatacatcgaagaa
ggcgcagatattaaaaaagaatattatgttggcttcgtaatcgaccgtgcaacagatcgt
gttactttgatggcgtctgaagaaggcggaactgaaattgaagaagtagcagcaaaatca
ccagaaaaaatctttaaagaaacaatcgaccctgtcgttggtttagcaccattccaagcg
cgtcgtattgctttcaatatcaatattccaaaagaatcaatcaataaagctgctaaattc
ttaatagctttatacaatgtgtttattgaaaaagattgctcaatcgttgaaattaaccca
ttagtattgactggtgaaggcgatgttttagctttagatgctaaaatcaactttgacgat
aatgctttattcagacacaaagatattctagaattacgtgatttagaagaagaagatcca
aaagaaatcgaagcttctaaatatgatttatcttatattgctttagatggcgacattggc
tgtatggttaatggtgctggtttagctatggcaactatggatacaatcaatcattttggc
ggaaatcctgcaaacttcttagacgtagggggcggcgctacaaaagaaaaagttactgaa
gcattcaaaatcatcttaggtgatgacaatgttaaaggtatctttgtaaacatcttcggt
ggtatcatgcgttgtgatattatcgctgaaggtatcgtagcagcagttaaagaagtcgac
ttaacattacctttagttgttcgtcttgaaggtactaatgttgaactcggtaaacaaatc
ttaaaagattcaggtttagcaatcgagccagcagctacaatggctgaaggtgctcaaaaa
attgtgaaacttgtcaaagaagtctaa

DBGET integrated database retrieval system