KEGG   Staphylococcus carnosus: Sca_0971Help
Entry
Sca_0971          CDS       T00863                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sca  Staphylococcus carnosus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sca00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Sca_0971 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sca_0971 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Sca_0971 (thrC)
Enzymes [BR:sca01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Sca_0971 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
979640..980707
Genome map
AA seq 355 aa AA seqDB search
MKRWQGLVQEYKDYLPVNENTPNVTLNEGQTPLIHCDTLSEMLGINLYVKFEGANPTGSF
KDRGMVMAVTKAKEDGKKVVICASTGNTSAAAAAYAARSGLKAIVVIPEGKIALGKLSQA
VMYGAEIVSIDGNFDEALEIVKEVANEGGDIELVNSINPYRIEGQKTGAFEVVEQLGGHA
PDVLAIPVGNAGNITAYWKGFKEFNDKHGTGLPKLFGFQAEGASPIVQNKVVKNPETVAT
AIRIGNPASWDKAVTALDESNGLIDSVTDEEILEAYQLLASKEGVFAEPASNASIAGLIK
LHRAGKLPKDVTVTAVLTGNGLKDPDTAISLLDNPIKSLPNDKESIVKYIKGVMH
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagatggcaaggtttagttcaagaatataaggattatctaccagtaaatgaaaat
acacccaatgtaactttaaacgaaggccaaactccgttaattcattgtgatacgctttct
gaaatgttaggcattaatttatatgtgaaattcgaaggtgccaatccgacaggttcattt
aaagatcgcggaatggtaatggcagttacaaaagccaaagaagacggcaagaaagtagtt
atttgtgcttctacaggtaacacttcagctgcagcagcagcttatgcagcacgttcagga
ttaaaagcaattgtagtaattccagaaggtaaaattgcattaggaaaattatcacaagca
gtaatgtacggtgctgaaattgtttctatcgacggcaatttcgatgaagcattagaaatt
gttaaagaagttgcaaatgaaggcggcgatattgaattagttaattcaattaacccatat
cgtattgaaggtcaaaaaacaggtgcttttgaagttgtggaacaattaggcggacatgcc
ccagatgtactagcaattccagtaggaaatgcaggtaatattactgcttattggaaaggt
tttaaagaattcaatgataaacatggcacaggtttgccgaaattattcggattccaagct
gaaggtgcatcaccgattgtacaaaataaagtagttaaaaatcctgaaacagtcgcaact
gcaattcgaattggaaaccctgctagttgggacaaagcggtcacagctttagatgagtca
aatggcttaattgatagtgttacagatgaagaaatcttagaagcatatcaattattagct
tcaaaagaaggtgtatttgctgaaccagcaagtaacgcatcaattgccggcttgattaaa
ctccatagagctggaaaactaccgaaagacgtcactgtcacagcagtattgactggtaat
ggattgaaagatccagatacagcaatttcattattagataatccgattaaatccttgccg
aatgataaagaaagcatcgttaaatacatcaaaggagttatgcattaa

DBGET integrated database retrieval system